SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000003685 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000003685
Domain Number 1 Region: 379-607
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.94e-28
Family RecA protein-like (ATPase-domain) 0.0084
Further Details:      
 
Domain Number 2 Region: 167-318
Classification Level Classification E-value
Superfamily DNA primase core 0.0000112
Family Primase fragment of primase-helicase protein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000003685   Gene: ENSACAG00000003783   Transcript: ENSACAT00000003775
Sequence length 666
Comment pep:known_by_projection chromosome:AnoCar2.0:3:39284052:39292675:-1 gene:ENSACAG00000003783 transcript:ENSACAT00000003775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLPVRSLHHWCLRGRRVLSGRHPCRHYKKETLPSPDGPVPPASVTEIRQYLRAQDIPFH
DGYSCIHVPSVFVEEQQQVRHSYTLFIDKTTGRFVCTATLVEGNWQDFQASVELQHKGVA
GGSLEDIDKPRDHTGEDARHIWERAMPLWELLDEQETQEAKAKFGISSISNATLKRFGVR
YLRTAQALVFPWFSPRGTSLKGLKLLGVERQGETANYVENTLPRPSAYHNLFGLPLIGRR
DTEVVLTGRELDTLALHQATGLPILALPRGISCLPPGLLPYLEQFKRITLWLGEDLRSWE
AAKLFARKLNPKRCSLVQPSDQQLQPLEAFTRGLNLTKILRSALPAGHKAIISFRQLREE
VLGELANVEQVAGVKWARFPELNKLLKGHRKGELTVFTGPTGSGKTTFISEYALDLCMQG
VNTLWGSFEINNVRLAKIMLTQFAMGRLEEQLDKFDEWADRFEDLPLYFMTFHGHQNIKT
VMDTMKHAVYMYDITHIIIDNLQFMMGQEQLTVDRLAVQDYIVGTFRKFATENSCHVTLV
IHPRKEDEERELQTASIFGSAKASQEADNVLILQDRKLVTGPGKRYLQISKNRFDGDVGI
FPLEFSKTSLTFSSPIKAKTAKLKKMKDDNGVPPKKAPTGGASKKQRSQSPNHTTPETSP
NEPVKT
Download sequence
Identical sequences G1KC80
ENSACAP00000003685 XP_003218523.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]