SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000003746 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000003746
Domain Number 1 Region: 341-608
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.52e-86
Family Eukaryotic proteases 0.0000000422
Further Details:      
 
Domain Number 2 Region: 106-197
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-32
Family Kringle modules 0.0000419
Further Details:      
 
Domain Number 3 Region: 210-294
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-28
Family Kringle modules 0.00012
Further Details:      
 
Domain Number 4 Region: 45-106
Classification Level Classification E-value
Superfamily GLA-domain 4.04e-19
Family GLA-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000003746   Gene: ENSACAG00000003853   Transcript: ENSACAT00000003837
Sequence length 612
Comment pep:known_by_projection chromosome:AnoCar2.0:1:43136103:43162495:1 gene:ENSACAG00000003853 transcript:ENSACAT00000003837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQSRTKMLRAFLLISLVHFTQSYDKVFLEQRQAFSMLKRTRRANKGLLEEMRRGNLERE
CLEETCIYEEAREALESDVKTDIFWAQYKVCKSQMTPRANLDECLKGDCAKDMGQNYRGT
ISVTKSGIECQYWSSKFPHRPTFNVTSHPHADLTENYCRNPNDNAQGPWCYTRDPVMRKE
ECAVPVCGENQTTVPFSPRTSLQQRKQAQQPCVPDKGLLYTGTLSVTRSGAQCLPWASEK
TRHLIQRRDFLPSVNLVENFCRNPDGDDEGVWCYVENPNVTHEYCDLDYCASYVDDVDED
QRAGRTSTVEHQILFNPSTFGDGEADCGVRPLFEKKKISDNSEQELLDSYQGGRVVKGSD
ADLGSAPWQVMLFKKSPQELVCGASLISNRWVLTAAHCIFYPPWDKNFTTDDLLVRIGKH
NRKKYEIKMEKIVLLDKIIIHPKYNWKENLDRDIALLRLKKPVAFSDFILPVCLPTKEIV
QSLLLTGYKGRVTGWGNLFETWTSNPSVLPNVLQQVNLPIVDRETCKASTKIKVTDNMFC
AGYSPEDSKRGDACEGDSGGPFVMKHPTLERWYQVGIVSWGEGCDRDGKYGFYTHVFRLR
KWLQKTTERHGL
Download sequence
Identical sequences G1KCA5
ENSACAP00000003746 ENSACAP00000003746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]