SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000005137 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000005137
Domain Number 1 Region: 525-765
Classification Level Classification E-value
Superfamily VPS9 domain 1.44e-53
Family VPS9 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 74-184
Classification Level Classification E-value
Superfamily SH2 domain 6.19e-16
Family SH2 domain 0.0032
Further Details:      
 
Domain Number 3 Region: 783-859
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000269
Family Ras-binding domain, RBD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000005137   Gene: ENSACAG00000005226   Transcript: ENSACAT00000005254
Sequence length 886
Comment pep:known_by_projection chromosome:AnoCar2.0:4:80457274:80500280:1 gene:ENSACAG00000005226 transcript:ENSACAT00000005254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQMLDKRDSTVYLIDTIASEIGELKQEMVHTDLVLEDGPTSLQSYSLDKAMGDVYSDHQK
DLKSITRDSGYDSLPNKLSILDKLLHTHPIWLQLGLNDSEASEVLHSQPPGTFLVRKSTK
MQRKVLSLRLPNDCGLFLKEFAIKESTYTFSLESSGISFADLFRLIAFYCISRDVLPFTL
KLPHVVAAATTEAELEEVAQLGLNFWSSPANKKLQNPSPLQKPLPSESISKGSQQLCLIN
GVHSIRTRTPSELECSQTNGALCFINPLFLKVHSQDVGGSLKRQCPRTQDVNGSERPRSP
PPRPPPPSIHSLLASPQLSRTVNQASLPDTVDSSRHGNLDVLQKRPIPIPPPRLKKKALS
LEVESNAKNSAGAGLSCNIVHGSEAVSIPGGAPPQQNLAESKKSLAAHSESQVQWNGGRQ
RLSDMSLSTSSSDSLDFDRSMPLFPYDGDTNSSLEEYEGESDQESMAPPLKPKKKRTSSF
VIPKIVKSQLRKVSGVFSSFMTPEKRMVKKIAEMSRDKRTYFGCLVQDYVSFLLENKECH
VSSTDMLQTIRQFMTQVKSYLSQSSELDPPIESLIPEDQIDVVLEKAMHKCILKPLKGHV
DVMLKEFHTADGSWKQLKENLQLVRQRNPQELGVFVPTPDFVDVEKIKVKFMTMQKMYSP
EKKVMLLLRVCKLIYTVMENNSGRMYGADDFLPVLTYVVAQCDMLELDAEIEYMMELLDP
SLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLCSEARNTLRQWHKRRTTNRTIPSVDDF
QNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCRLCAEKFKVDIPDDYSLFLFIDDTWQQL
TEDTYPQKIKAELHSRPQPQVFHFVYKRINSDPYGAIFQNNIDYHS
Download sequence
Identical sequences G1KDU4
ENSACAP00000005137 ENSACAP00000005137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]