SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000005349 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000005349
Domain Number 1 Region: 47-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.25e-29
Family SCAN domain 0.00017
Further Details:      
 
Domain Number 2 Region: 406-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 451-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-19
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 353-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-18
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 305-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000169
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 6 Region: 161-204
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000103
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000005349   Gene: ENSACAG00000024701   Transcript: ENSACAT00000005466
Sequence length 508
Comment pep:novel scaffold:AnoCar2.0:GL343434.1:413877:421746:-1 gene:ENSACAG00000024701 transcript:ENSACAT00000005466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DASQVLVCWGLPENLRVRGEMIWQKAMLCTQPKPKPHSLDLYSTPKQRQRFRQFSYQEGE
GPREVCSRLHDLCRQWLKPEQHTKAEMLDLVILEQFLSLLPPEMGSWVRECGAETSSQAV
ALAEGFLLSRAEDKRMRLREVMMVLYSALARTNTVSGCGHHQGPIAFEDVAVHFSLEEWV
LLNPDQKILHMQTMEEIHEIVDSLVESHLSKLNGPAEPWVMILQIKHKNIMLYNKFDRKS
SSIRSNVMLNALDNPEPWISESWITDNWKKSNMQCMWAMFCPKYGTYSSQDTPCQENPFQ
MESIRSLLTTHQRIHTREKTYKSQECEKFFTQSSHLLKHKRFHTGEKPYRCQNSVLVNQQ
RIHTKEKKYKCLECGKCYIRDSSLVAHQRVHTGEKPYKCQECDKCFPCKSSLLRHQSIHT
GNKPYKCQECGKCFAQNAHLIDHWRSHTGEKPYKCNECGKCFVRNSSLASHQRVHTGEKP
YRCSDCGKSFAYSSDVVRHKKLHTGEKP
Download sequence
Identical sequences H9GA88
ENSACAP00000005349 ENSACAP00000005349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]