SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000005355 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000005355
Domain Number 1 Region: 352-489
Classification Level Classification E-value
Superfamily C-type lectin-like 1.59e-45
Family C-type lectin domain 0.00016
Further Details:      
 
Domain Number 2 Region: 635-780
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-36
Family C-type lectin domain 0.0000126
Further Details:      
 
Domain Number 3 Region: 1220-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-35
Family C-type lectin domain 0.00018
Further Details:      
 
Domain Number 4 Region: 801-945
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-34
Family C-type lectin domain 0.00082
Further Details:      
 
Domain Number 5 Region: 503-638
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-33
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 6 Region: 950-1089
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-31
Family C-type lectin domain 0.00065
Further Details:      
 
Domain Number 7 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.69e-31
Family Cysteine rich domain 0.00000428
Further Details:      
 
Domain Number 8 Region: 1089-1216
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-30
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 9 Region: 228-343
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-29
Family C-type lectin domain 0.00093
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 7.99e-20
Family Fibronectin type II module 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000005355   Gene: ENSACAG00000005361   Transcript: ENSACAT00000005472
Sequence length 1457
Comment pep:novel chromosome:AnoCar2.0:6:18062808:18115005:-1 gene:ENSACAG00000005361 transcript:ENSACAT00000005472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVPLLLAFLSVFHGADSLVDTSKFLIYNQDHKVCVNALSSSYVTTDTCNHENEGQIFRW
ISSHQLMSISLKLCLGVSSKVDWTPVTLYPCDTDSSLQKWECRNDTLFAIQGADLFFNYG
NKNEKRIMLYKGSGLWSRWKVYGTQDDLCSRGYEDTFTLKGNSNGAPCVFPFQYGSNWYA
ECTNLARSDGFLWCSTTRSYNTDKKYGFCPVKSDATEQLWKKDPMTSIQYQINSEAALSW
YQASKSCQQQSAHLLSITELHEQTYLAGLTSSLTTELWFGLNSLDFNSGWQWSNGYPFRY
LNWAPGSPSPEPGKTCGTFNPGKGGKWESLECEKKLGYICKRGNSTLNNFIIPSESNVPF
KCPEGWISYGGHCYKINRETALWNDALTLCRKEGGDLASIHNVEEYSFIFAQLGYRPTDE
LWIGLNDLKVQMCFEWTDGTPVTYTKWLPGEPTHATNRQEDCVVMKGKDGYWADQQCDVK
LGFICKRKPLKEAPEEQDKIEEGCQRGWKRHGFYCYMIGNVFSTFAEANHTCIKEGAYLT
SVEDRYEQAYLTSLVGLRPETYFWIGLSDIQEKGTFIWTNGEPIKFTHWNSEMPGRKPGC
VAMTTGISGGLWDLLKCEKKAKFLCKRFADGVTPPPPLTTTPPPKCPEYWGPSDERSLCF
KAFVTADNLKSWVDARTFCTEIGGELASLISSKEERSLQRYLASSGYSNQRYWIGLNYLS
PTEGFAWSDGSPLGYVNWAYGEPNNYNGIEHCGELNANVGMRWNDMHCEDLFYWICQIRK
GEQPKPEPTNRPLPKYVFTSDGWVINEDKQYYFGTDNAPMEKAREFCKKNFGDLAVIENN
SERKFLLQYISQNKTVDSYFIGLQLSLDKVAKWMDGTPVQYLAWAPHEPNFANNDENCVV
MYRRTGCSGLWNDINCGYPSPLICERHKNMVNTTAAPTAPSVRYCGFVVWLCYNLECYKI
FGFQADDQKSWSAARSECQGPDIGGNLATISNKRLQAFLVFHLNSQRKVWIGLNDINHEH
MYLWTDGTGVHYTNWAKSYPSSSYDGSMEDCVAVNNKPLKEAGTWRHFRCSIKKGYICQT
NTNSKYSIPSTTPVPHIYYSNSTYFFIETKMTWKEAQQRCGVQKEDSSLASILDPFSHSL
LWLQVLKYKSPVWIGLNSNVTDGQYTWIDRYRMKYTNWGTGEPKQNFGCVYIDLDGAWKT
GSCDEKYFPLCKHSVLKAPTEPPQQPGKCPESEEKPWLPFRGHCYHFEASARKNWPRASL
ACLQLDANLVSIVDATESRFLAENIEALETKTRTFWTGMYKNLNGNWLWLDNTVVDFVNW
NTGEPSPQINEECVEMYTTSGNWNNAYCSGYAGYICKKPKVFDSVPTEKIPEQKESRKEE
NKPSSSNSKATAVVVIVILIVAGAALAGYYFYKKRNQHLVTEENFENSLYFNSNSAPGTS
DTKDLVLNMEQNEHGAI
Download sequence
Identical sequences G1KE51
ENSACAP00000005355 ENSACAP00000005355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]