SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000005550 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000005550
Domain Number 1 Region: 40-468
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.44e-70
Family Integrin alpha N-terminal domain 0.00000657
Further Details:      
 
Domain Number 2 Region: 779-1002
Classification Level Classification E-value
Superfamily Integrin domains 7.06e-39
Family Integrin domains 0.0018
Further Details:      
 
Domain Number 3 Region: 468-617
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-27
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 4 Region: 619-760
Classification Level Classification E-value
Superfamily Integrin domains 3.45e-19
Family Integrin domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000005550   Gene: ENSACAG00000005508   Transcript: ENSACAT00000005672
Sequence length 1053
Comment pep:known_by_projection chromosome:AnoCar2.0:6:77195620:77265779:1 gene:ENSACAG00000005508 transcript:ENSACAT00000005672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPGCQPCRTKSPLCGQKILLFLAPTWWISLLVLPCAAFNLDTKFVVLKKGKTPESFFG
LSVALHHQTKPEKYLLLSGAPRDVASEMDNTTRMGAMYACPLSASTEDCKRVDIKVLSEP
RNNIVEDMWLGVEVASQRTASGRVMACAHRYTRILWAGNEDQRRMVGKCYIRGNDLGLQE
DDEWQAYHNEMCNANTDLESTGMCQMGISGGFTHNSVYFGAPGAYNWQGTDYVLQRESWD
QKDYSYPDEKRSNSYIGYTTEASTAVLHKHSNTFIAGAPRYNHTGAVFLMLNDSGTTLEE
KLVLLGEQVGSYFGSSIALADLNNDGWKDLIIGAPYYFDRKEEKGGAVYVYMNLGGTFHS
SANLTLTGPSNSSFGLAVASIGDVDKDDFQDIAIGAPFEGSGKVYIYHSSVGGLIDKPRQ
IISGNDFVPSIPTFGYSFSGGMDVDGNSYPDLLVGTLSENLLLLRARPVINIVSKTFTVT
PNPLDPAKCTEDSCIKVQFCFSYSQSAGDPKYKETIKLNYVIKADQDRRRVYFAKTQSAV
YRGQFSMPNEKCQTLKVLLRDDVRDKLHPIAFSMNYSLAEKSRKFRLGPQSLDAFPVLNE
DQPRENHTEIQFQKECGTDNKCHSNLQVQAVYLNDQNQMLPRRNGMQILQYSRDVKKLNL
NITVTNQPTSPTNGEDAHQALLNITFPLSLLPSSVRPSGACTFNGGVLCQLGNPFKRNQQ
AELIITFEVIGISLYTQDVIIQVEPSTLSQQDDLTAISAVLLVDYTIDASLRILNPWLQS
HFSGTVMGESAMKHEEDVGSPIRFHFQVTTKGESLGSLGTIMLGFEWPYEVSNGKWLLYP
TDIMVKGNEEWFCEPPGQVINHLNLSLNVHQRNHSSNLTRKKRELEASSKSEVPITLAAA
KKAKSDTSLSCSEGTSRCIWFECPLKDIGAVTDVTVRARVWNSTFIEDYHDFDRVKVMGQ
ATLFLRTNVSTINMKNGTVWYTVNIDSELSEEQPAELELWLVLVAVAAGLLLLGIIVLLL
WKCNFFKRTRYYRIMPKYHAIRIRQEERYQPAG
Download sequence
Identical sequences G1KEH5
ENSACAP00000005550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]