SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000005791 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000005791
Domain Number 1 Region: 326-454,727-900
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.7e-51
Family Diacylglycerol kinase-like 0.022
Further Details:      
 
Domain Number 2 Region: 58-181
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-30
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 3 Region: 1108-1174
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.29e-19
Family SAM (sterile alpha motif) domain 0.0044
Further Details:      
 
Domain Number 4 Region: 227-296
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.19e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000293
Further Details:      
 
Domain Number 5 Region: 167-223
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000478
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000005791   Gene: ENSACAG00000005773   Transcript: ENSACAT00000005919
Sequence length 1181
Comment pep:known_by_projection chromosome:AnoCar2.0:3:35988944:36073294:1 gene:ENSACAG00000005773 transcript:ENSACAT00000005919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAVGASQPQQPQAGAAPVAPTAAPEESSDSEPEQEPGSPQKLIRKVSTSGQIRQKTI
IKEGMLMKQTSSFQRWKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVNNS
FTVITPCRKLILCADNRKEMEDWIAALKTVQNREHFESTQYSMDHFSGMHNWYACSHARP
TYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGISM
PHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCRDLLPTKCPLGLCKVS
VIPPTALNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDL
MNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLSLHKQCQLGVLPLGTGNDLAR
VLGWGSACDDDTQLPQILEKLERASTKMLDRWSIMVYETKLPRQASASTGTEDFSEDSEV
QQILFYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYERAPESSEESEV
MATKCSVLKEKLDSLLKTLNEESQASSSLPNPPPTIAEEIEDGDGSANACDSSSDRSVGS
SCPTRPQIFRPREQLMLRANSLKKAIRQIIEHAEKAVDEQNAQTQEQESFLLCLSNTEEG
KDLRNENKITLQSLHAGSYGFPKGRSHRKDIRAGASGSLPGGSVISRLLINADPFNSEPE
NLDCYVEKCVMNNYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRT
YKNLEQKVLLECDGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTFTAPSFDDKILE
VVAVFGSMQMAVSRVINLQHHRIAQCRTVKIAILGDEGVPVQVDGEAWIQPPGYIWIVHK
NRAQTLTRDRAFENTLKSWEDKQKCELARPPSFSLHPEIISEEESIHINQFCRAAGALIH
SIREIAQSFQDMEQELAHAVNASSKSMDKVYAKSKSTEGLNCNLVVEMVNNVKALHNETE
LLLAGKMALQLDPPQKEQLLAALNEMDLHMRKLADIPWLWQLMEPSDEENQMLEYSKRSR
SGKFRLVTKFKKDKNNKNKETRSSLGLPVHLWGTEEVAAWLEHLSLCEYKDIFIRHDVRG
SELLHLERRDLKDLGVTKVGHMKRILHGIKELSKNIPANEA
Download sequence
Identical sequences G1KET4
ENSACAP00000005791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]