SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000006106 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000006106
Domain Number 1 Region: 353-594
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.77e-68
Family Nuclear receptor ligand-binding domain 0.000000000934
Further Details:      
 
Domain Number 2 Region: 230-311
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.95e-29
Family Nuclear receptor 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000006106   Gene: ENSACAG00000006213   Transcript: ENSACAT00000006243
Sequence length 642
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343259.1:1338818:1578780:1 gene:ENSACAG00000006213 transcript:ENSACAT00000006243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHNMLLKGHMTLSANCRTTEAMETSFWDKSGLPAADSSWSSKSRYATCSLPLTLTMTLH
TKTPGVALMHQIQGNELEPLNRPQMKIPLERPISEMYVDSSKTGVFNYPEGSVYDFSTAA
PVYSSTSLTYAPTTESFGSNSLGGFHSLNNVPPSPVVFLQTAPQLSPFIHHHNQQVPYYL
ENEPNSFAMREAAPTAFYRPGSENRRHNGRERMSSTSEKGSLPMESTKETRYCAVCNDYA
SGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMK
GGIRKDRRGGRMLKHKRQREENDSRNAGALTEARSTALWPSPLMIKHSKKNSPALSLTAD
QMVSALLEAEPPVVYSEYDPSRPFNEASVMTLLTNLADRELVHMINWAKRVPGFVDLALH
DQVHLLECAWLEILMVGLVWRSMEHPGKLLFAPNLLLDRSHGKVVEGFVEIFDMLLATSS
RFRMMNVRGEEFVCLKSIILLNSGIYTYLSSTLKSVEEKDHIHRVLDKITDTLMHLMAKS
GLSLQQQHRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPA
AKGSPPSEDDPLNQLAVPSPSMHSLLPCYVNKQEEGNEQEAI
Download sequence
Identical sequences H9GB48
ENSACAP00000006106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]