SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000006264 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000006264
Domain Number 1 Region: 121-233
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 3.4e-34
Family Elongation factor TFIIS domain 2 0.0037
Further Details:      
 
Domain Number 2 Region: 5-93
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 8.24e-26
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000966
Further Details:      
 
Domain Number 3 Region: 251-300
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.67e-16
Family Transcriptional factor domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000006264   Gene: ENSACAG00000006351   Transcript: ENSACAT00000006403
Sequence length 302
Comment pep:novel chromosome:AnoCar2.0:4:155353864:155374485:-1 gene:ENSACAG00000006351 transcript:ENSACAT00000006403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMGGEQEIVRIAKRLDKMVAKKSAEGAMDLLKELKSMPITLHLLQSTRIGMSVNALRKQS
TDEDVIALAKSLIKAWKKLLDASEDKGNEKKRNSLPTSSSRESGDSKDQSSIKRQDLPKT
PTTPKITTFPPVPITCDTVRSKCREMLTSALQTDNDYVAIGVDCEEMAAQIEAFELIYQD
VKNTDLKYKNRVRSRISNLKDSKNPDLRKNVLCGVITPEQIAVMTSEEMASNELKEIRKA
MTKEAIREHQMAKTGGTQTDLFTCGKCRKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWK
FC
Download sequence
Identical sequences G1KFC1
ENSACAP00000006264 ENSACAP00000006264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]