SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007094 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007094
Domain Number 1 Region: 180-302
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 4.45e-59
Family Dystroglycan, domain 2 0.000000602
Further Details:      
 
Domain Number 2 Region: 60-158
Classification Level Classification E-value
Superfamily Cadherin-like 2.67e-17
Family Dystroglycan, N-terminal domain 0.000011
Further Details:      
 
Domain Number 3 Region: 490-589
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000314
Family Dystroglycan, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007094   Gene: ENSACAG00000007264   Transcript: ENSACAT00000007247
Sequence length 888
Comment pep:known_by_projection chromosome:AnoCar2.0:2:146811198:146901552:1 gene:ENSACAG00000007264 transcript:ENSACAT00000007247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLGFVQLSPVLGRTLLVLMVITSVKCHWPSEASEVVRDWENQLEASMHSVLSDLRESVP
AVVGIPDSSAVVGRSFRVTIPTDLIASNGEVIQIIEAGKESLPSWLHWESESSTLEGLPL
DTDKGIHYISVNAMHLFSNGSYVPQTTNVFSIEVHPEDHNEPQSVRVASQDANEAAPFVC
SAEEPVTILTVILDADLTKMTPKQRIELLNRMRTFSEVELYNMKLVPVVNNRLFDMSAFM
AGPGNAKKVVENGALLSWKLGCSLSQNSVPNISNVESPAKEGTMSAHLGYPVVGWHIANK
KPNLPKRIRRQINATPTPVTAVGPPTTALQEPPIRIVPTPTSPAIAPPTETAAPPVREPV
PLPKKPTVTIRTRGAIVQTPTLGPIQPTRVVEGTSTTPGQIRPTMTGQIEATAAVTPPTT
KRPKGTPPKPATPSTTDTGTTRRPRPTKTPRPPKPPRTTKPSLIDQKAVSPPTRIRTTTV
GVPRVPNDPPELKNHIDRVDAWEGTYFELKIPSDTFYDKEDTTTDKLQLTMKLENEKPLE
ENFWVQFNSTSQLMYGLPNRTNLGRHEFFMHATDKGGLSTVDAFEIFVHTFAGKVSPVKF
KAKFHGDYNAVVNDVNKKIMLVKKLAFALGDRNSSTITIESIDKGSIVVEWTNNTLLPLT
SPCPKEMIRTMSKKISDDSGGPSPAFTNALEPEFKPINISVVGAGICRHIQFIPVMREGL
PTTAPPTVVAPPDPEKTSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLTIED
QATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQNMPETTPLNQDTI
GEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences G1KGB5
ENSACAP00000007094 XP_003217594.1.98722 XP_016847052.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]