SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007367 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007367
Domain Number 1 Region: 180-410
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.43e-43
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 2.94e-32
Family Tetramerization domain of potassium channels 0.00000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007367   Gene: ENSACAG00000007541   Transcript: ENSACAT00000007523
Sequence length 647
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343326.1:1134769:1229754:1 gene:ENSACAG00000007541 transcript:ENSACAT00000007523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVAAWLPFARAAAVGWLPLAKKPMPKPPPDKKRRTDEILVVNVSGKRFQTWKNTLDR
YPDTLLGSSEKEFFYDEDSTEYFFDRDPEMFRHILNFYRTGRLHYPRHECIQAFDEELSF
YGIIPELIGDCCLEEYRDRKKENAERLAEDEEAEIATDTALPPDSTFRQRLWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETIPCRPPPGKKRNQPCGERFPNAFFCMDTACVLIF
TFEYLMRLFAAPSRFKFMKSVMSIIDVVAIMPYYIGLVMPENENVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTAETNFTSIPAA
FWYTIVTMTTLGHSDMLGQQICRRVYGSFAALLSSHVCFFSLPLPVLFSYKNFARSYFQN
HRMDMREASHKLPLPRKKRGKEGTCLSFLKQKLNNTLQASDRDPDTHALAVRNRSAFEQQ
HHHLLHCLEKTTSHEFTDEHSYSEFCLTEPLGYRTSRSTSLSSQQGSKGGLSSSCCPRRT
KRRPTRLTNSTMTMSRASAQELDTINSQKSAAPQSRSSLNAKTHDNLKLNCDTPDFTAAI
ICIPTPPANTPDESRPPSPGGGSSGPLRNSSLSTPYILHETVKISSL
Download sequence
Identical sequences H9GCR2
ENSACAP00000007367 ENSACAP00000007367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]