SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000008451 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000008451
Domain Number 1 Region: 1166-1361
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000252
Further Details:      
 
Domain Number 2 Region: 950-1073
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-32
Family Pleckstrin-homology domain (PH domain) 0.00000232
Further Details:      
 
Domain Number 3 Region: 43-163
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-19
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000008451   Gene: ENSACAG00000008596   Transcript: ENSACAT00000008633
Sequence length 1982
Comment pep:known_by_projection chromosome:AnoCar2.0:6:15289129:15419344:1 gene:ENSACAG00000008596 transcript:ENSACAT00000008633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRWAEGGDGREALARSFSQVSKNKDGKEQSEAVSLSEDEEAFSWPGPKTVVLQRTSQG
FGFTLRHFIVYPPESAVQFSFKDEENGNKGGKPRNKLEPMDTIFVKQVKEGGPAFEAGLC
TGDRIIKVNGESVIGKTYSQVIALIQNSDSILELSVMPKDEDILQLLQFSKDVTALAYSQ
DAYLKGNEAYSGNAGNIPEPPPICYPRLTSPATGMAQPIEKASPDSAQRKQTTSKPVRTS
AQPEKAYRMEIQVPPSPTDVAKSNTAVCVCNETVKTVVVPSEKAVDFSLCRTNHTTPSHR
IEELSYGFKEQATPKTKARTTSPSSSMSTAIVLPQTPLTRPVDPSGITNTSGTFGRHPEE
VTTTRSPTRSVGSPSITTNHYTSPNAHQHIDWKNYKTYKEYIDNRRLQMYGCRTIQERLD
SLRAASQNTTDYNQMVPNRTGSQVRRRSTSHDRVLPAIQVRQKSASQERLEDPNVVLNEW
PRSASQDALTSPPLSPRNYRTRSWDYLGKQGDTIENLHADNFVGDPNRDKKKTYQWTGFT
EQDDRRGFHERTRLQAFHLSFRGSKFFGAPGAYNPDGRLISNRALGSAPHFQKISPDGKT
LQPVRNLPAAGGTSKPATIFQERLSHSTARSTRSNSLKTSIPYAAKPSLPLNQSLDSVTT
RNQRAVNDVHHSSLFNQQSRIHAESVPDRKVDLGKSTLSPTSCIASAKFVPQMSEHLTTS
VSLDVSVRQKVRDFEKEDEIRPSHVDQETETVVLREKSPSGHQTPQLLRHQSYILAVNDP
EPASETTCWLPNDARREVHIKRIEERKASSSSPPGDSLASIPFIDEPASPSTDHDIAHIP
ASAVISASSSRAPTITTVPPSPTSLVPLIRRQLSHDHESIRASIVDGQFPTKSERSKSYD
EGLDDYREGKVAIKHVSSLKGIKAPDSQTSSENSGSRKASSSEIFGDASKVGWLYFRQLV
TDKGKRVGGSIRPWKQMHVVLKGCSLYLYKDKKEQVVPSEEEQPISINACLIDISYSDTK
RKHVFRLTTSDCEYLFQAEDRDDMLAWIRAIQENSNLNTENTGVTSRDLISRRIKEYSTM
MSASSGKTEPSPKPSRQGLSIRQTLLGNKTESRTQSPHSPKEESERKFLGKEKDETSPPK
DKGTWRKTIPNIMRKTFEKKPSAVGTFGVRLDDCPPAQSNKYIPLIVDVCCKIVEERGLE
YTGIYRVPGNNAAISSMQEELNKGMTDIDVQDDKWRDLNVISSLLKSFFRKLPEPLFTND
KYGDFIDANRREDPVERLKTLKRLIRDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNL
AIVFGPTLVRTSEDNMTHMVTHMPDQYKIVETLIQKHDWFFAEDDAEEPLTAVQEENTVQ
SQPVPNIDHLLTNIGRTGVSPGDVSDSTTSDSAKSKGSWGSGKDQYSKELLKSSIFAAAS
RKRKKPKEKPQPSSSEDEFDSVFYKKESVEHCHDSSAKEEAQKEDPEKETARRKLRTTVP
KEKENNNKKMPTGTKDEILPVKEGLTSEDPSTPYLQKYVRSPNLSFRLSTPKACIKSPVL
HISSQIEETISDSGTILSSSSQASLQKFPSKKLASEFLEADVNSITSDYSTISSATYLTG
LDSTMLTPESVTGSKGEEADDERSELISEGRPVETDSESDFSVFAASSAVERLFRGKRQD
VSKGSRRNSEESEVSCTEGSLTPKLDSRRLFSSHKLIECDTLSRRKSARQKTDSEGSGDA
KCEKESLAVTKMFDIMKKGKSTGSLAAVSKSEPEKQEPTWRLKITDRLKQRLKSSADDMF
GVGNQKSNSTEISKRKNIRRRHTLGGQRDFAEISVLNAWKAQEKNPSREKDISAVDRLKP
KCPVQDLSISGWLAQERLQTSTTELKTGESGEPKKGKTSRLADLSEPSSSAETWAEEGGS
SSSSSLTLVSRAPVSGQLQPLDHVNGESYQSMNRNNFSPTIDAHPHKLSGNQVVRSRFYQ
FL
Download sequence
Identical sequences G1KHZ9
ENSACAP00000008451 XP_008110612.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]