SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000009385 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000009385
Domain Number 1 Region: 233-323,381-417
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.4e-17
Family SPRY domain 0.035
Further Details:      
 
Domain Number 2 Region: 66-186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000324
Family SPRY domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000009385   Gene: ENSACAG00000009575   Transcript: ENSACAT00000009580
Sequence length 424
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343212.1:2793454:2842692:1 gene:ENSACAG00000009575 transcript:ENSACAT00000009580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDLNLHYRFLNWRRRIREIREVRAVRYQERFKHILVDGNRLSYQGNSGEVGCYVAPRPL
TIDNNYFEVSIVDSGVRGTIAVGLVPQYYSLDHLPGWLPDSVAYHADDGKLYNGRAKGRQ
FGTKCSSGDQIGCGIEPVSFEVQMAQIFFTKNGKRVGSTIMPLSPEGLFPAVGMHSLGEE
VRLYLHAELGNEEEDDSVMMVDSYEDEWGRLHDVKVCGTLLEYVGKGKSIIDVGLAQARQ
PLSTRSHYFEVEIVDPGEKCYIALGLARKDYPKNRHPGWSRGSVAYHADDGKIFHGSGVG
DPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTVAIKAKPRGVMNVLYLHQEAEED
EDEEEDGEDMEQEHEGKKVVVFFTRNGKIIGKKEAVVPAGGFYPTIGMLSSGEKVKVDLH
PLSG
Download sequence
Identical sequences H9GFC7
28377.ENSACAP00000009385 XP_008113304.1.98722 XP_008113305.1.98722 XP_008113306.1.98722 XP_008113307.1.98722 ENSACAP00000009385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]