SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011193 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011193
Domain Number 1 Region: 361-584
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.9e-68
Family Nuclear receptor ligand-binding domain 0.000012
Further Details:      
 
Domain Number 2 Region: 98-188
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-29
Family Nuclear receptor 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011193   Gene: ENSACAG00000011374   Transcript: ENSACAT00000011427
Sequence length 586
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343357.1:624515:655017:-1 gene:ENSACAG00000011374 transcript:ENSACAT00000011427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELNAGGVITYISSSSSASSPASCHSEGSESSFQSSSSPVPTSPNSSPSESSCNIKSREV
FKEATKSDQLDDRIKANHSSPKGQIKGHSGLTKFNGMVLLCKVCGDVASGFHYGVHACEG
CKGFFRRSIQQNIQYKKCLKNNNCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKR
EKQRMLIEMQSAMKTMMNTQFSDHLPNETLKDSEEPVILLPQEELNSKMQREKETINRTS
PPPVLLPPLSAPPSDIAKEEVIGMVTRAHKDTFMYNQEQSENPPCVVQPQNGERNLKYTE
QYNSSGEPDHGDISSTQYGDSEQHFNGQYKGRNNVHYPNGRNLCFTSSSSMNFTHGFPLK
GCNRMPENGFPPNESMNAYSYNTGGRMHLVCPMNKTPFVDPNKSGHEVWEEFSMSFTPAV
KEVVEFAKRVPGFRNLSQHDQVNLLKAGTFEVLMVRFASLFDAKDRTVTFLSGKKYSLDD
LRSMGAGDLLNSMFEFSEKLNALNLSDEEMSLFTAVVLVSAERSGIENVNSVEALQETLI
RALRTLITKNHPNEASTFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Download sequence
Identical sequences H9GHL2
XP_008117168.2.98722 ENSACAP00000011193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]