SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012257 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012257
Domain Number 1 Region: 32-466
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.15e-83
Family Integrin alpha N-terminal domain 0.00000000127
Further Details:      
 
Domain Number 2 Region: 706-930
Classification Level Classification E-value
Superfamily Integrin domains 1.18e-50
Family Integrin domains 0.0000722
Further Details:      
 
Domain Number 3 Region: 569-697
Classification Level Classification E-value
Superfamily Integrin domains 2.2e-32
Family Integrin domains 0.0000696
Further Details:      
 
Domain Number 4 Region: 461-568
Classification Level Classification E-value
Superfamily Integrin domains 1.46e-18
Family Integrin domains 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012257   Gene: ENSACAG00000012258   Transcript: ENSACAT00000012508
Sequence length 980
Comment pep:known_by_projection chromosome:AnoCar2.0:6:64000512:64058099:1 gene:ENSACAG00000012258 transcript:ENSACAT00000012508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGFGSLGIPVPLWLFMGGFLPSHLPVWTLNLHASAPTVYAGPNGSYFGFALDFYRDGK
GRMNVVVGAPLANTSQPGVMEAGSVYLCPWGPSGGDCNPIEFDTKGDQVAQQGYIRMEVF
KSKQWFGASVNTWKDNIVACAPLQHWNAFVGQDQATKTPVGSCFLASEGLRRFSEYSPCR
DIRMQSFYSSISYGNDKRYCELGFSSAISNSGNAVFGGPGGYYFGGLIYSINASVIQSSL
PRLLWSVPSQYVTSDFSDWTYNDGYRGYSVALGEFNEDATSDEYVVGVPNKSQTKGVVEI
LTLKKIFRVLWTIPSEQIASYFGHTVAVADVNGDGKDDILVGAPLFMERRLDRKLYEVGR
VYLYLQHKTPNAYSNPWQRLTGTDVYGRFGMAIAPLGDIDQDGYIDIAVGAPFAGRDEGG
RVYIYHGGNDGLSASPKQFLENPFTGPAGFGFAIRGASDVDANGYPALNAELQLDRMKQR
FGRRVFLLQNSQSSRMFPLELSGKIPHTCQNVTAYLRDETDFKDKLSPIAVSLNFSLASI
SRVEELQPVLYGQLMIQEQTRIILNCGDDNICIPNLKLSAHTNEGSLLIGADNVLLIQVT
AVNDGEGAYEAELIVELPAGAYFQKASSSTQKLICNSRKENETRLVACEMGNPMKAGTEI
KVDVELSVSQLENAEDTISFMLQLKSKNSLNSSSNVLRLPVPVKVAAKMELLGISAPTAI
VLPVATDYKNNSMKADDYGPKVEHIYRLQNAGPSTVSGAELLVDFPNNFWDGFLLYITRV
NTEGNIACSPMNETNPLKLELQEPMTTPSSNRSIQEGRWRQKRDLSPVTPEEPAVMVNCS
SQICAVLHCQVGLLEKGQGAMVTIHAVLWLPSFRERPVEQFLIQSQAQFSVSGMPYHIQP
EVLPSGSAVAKTRIEWVNPDAERKIPVWWIIVAVLVGLLLLAAFIIILWKTGFFKRKRPP
TEDEEQLTNEPGAQSSGDGN
Download sequence
Identical sequences G1KME1
ENSACAP00000012257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]