SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012672 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012672
Domain Number 1 Region: 180-194,356-593
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-64
Family Nuclear receptor ligand-binding domain 0.0000585
Further Details:      
 
Domain Number 2 Region: 112-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.06e-29
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012672   Gene: ENSACAG00000012771   Transcript: ENSACAT00000012928
Sequence length 605
Comment pep:known_by_projection chromosome:AnoCar2.0:5:30978340:30992534:1 gene:ENSACAG00000012771 transcript:ENSACAT00000012928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIEELAHQIIEQQMGEIVTDQQTGQKIQIVTALDQSATGKQFILTNHDGSTPSKVILA
RQDTTPGKFFLTTPDAAGVNQLFFTSPDISTQHIQILTDSSSTEQTLNKVFDLCVVCGDK
ASGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGTRDCVINKHHRNRCQYCRLQRCIAFGMK
QDSVQCERKPVDVSREKPPNCAASTEKIYIRKDLRSPLTATPTFVTDNETTRSTGMLEPG
MFVNIHQSGVKNEPTVLMTADKVETCQGDLSTLANVVTSLASLSKSKDVSQSSPDLSMIE
SLSNGDTSLTELQQDENANTDVTRAFDTLAKAFNPGETASCQSSAESMEASAHLFGEETT
TSIVEIEGPLLSDVHVAFRLTMPSPMPEYLNVHYICESASRLLFLSMHWARSISSFQALG
QDNSISLVKACWNELFILGLAQCSQVMNVATILAAFVNHLHNSLQQDKLSADRGKLVMEH
IFKLQEFCNSMVKLCLDGYEYAYLKAIVLFSPDHPGLENVQQIEKFQEKAYMEFQDYITK
VYPDDTYRLSRLLLRLPALRLMSAAITEELFFAGLIGNVQIDSIIPYILRMETADYNSQI
IGHGV
Download sequence
Identical sequences G1KMY6
ENSACAP00000012672 ENSACAP00000012672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]