SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013307 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013307
Domain Number 1 Region: 147-437
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.07e-89
Family Nuclear receptor ligand-binding domain 0.0000000108
Further Details:      
 
Domain Number 2 Region: 44-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-28
Family Nuclear receptor 0.00000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013307   Gene: ENSACAG00000013485   Transcript: ENSACAT00000013576
Sequence length 442
Comment pep:known_by_projection chromosome:AnoCar2.0:2:66240756:66352726:-1 gene:ENSACAG00000013485 transcript:ENSACAT00000013576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLFQNPWELYQPSIPNDLDTEMEIVAPCPPFPDPASDFDRNIPRICGVCGDKATGFHFN
AMTCEGCKGFFRRSMKRKAMFTCPFNGDCKITKDNRRHCQACRLKRCTDIGMMKEFILTD
EEVQRKREMIMKRKEEEALKESLKPKLLEEQQRIIDILLEAHKKTYDPTYSDFNQFRPPV
RGSRMKSRSSSIMTQGFSSSEDSLDTFSSSSPEPKMFSNLELSDDSDESASMSIDLSHLS
MLPHLADLVSYSIQKVIGFAKMIPGFKDLTAEDQIALLKSSAIEVIMLRSNQSFSLEDMS
WTCGSNDFKYKISDVTQAGHSLDLLEPLVKFQISLKKLNLHEEEHVLLMAICILSPDRPG
VQDTAMVESIQDHLSGILQTYILCRHPPPGNRLLYPKMIQKLADLRSLNEEHSKQYRCLS
FLPEHSMQLTPLVLEVFGNEIS
Download sequence
Identical sequences G1KNX9
XP_008101719.1.98722 XP_008101720.1.98722 ENSACAP00000013307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]