SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013825 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013825
Domain Number 1 Region: 42-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 2 Region: 93-125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000484
Family LDL receptor-like module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013825   Gene: ENSACAG00000014100   Transcript: ENSACAT00000014107
Sequence length 175
Comment pep:known_by_projection chromosome:AnoCar2.0:4:105140534:105149367:1 gene:ENSACAG00000014100 transcript:ENSACAT00000014107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CTRRCICVSAIGFIILAIIIAAIAIIVTVGIPPRTAVNRLCVTTSNQTGFLCDNRETCIT
ASQVCDTRRHCANGEDEQKTLCSDLPNNLPGYLIFHCGNPRYWIPADKRCNGINDCGDCS
DEVGTWASCPPCGSQWWSCTMVVFHKYCTCIPRSLCRDGIQHCFDWSDEYICTNP
Download sequence
Identical sequences G1KPG8
ENSACAP00000013825 ENSACAP00000013825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]