SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000014848 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000014848
Domain Number 1 Region: 966-1244
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 8.01e-82
Family Complement components 0.0000561
Further Details:      
 
Domain Number 2 Region: 1314-1433
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.62e-34
Family Alpha-macroglobulin receptor domain 0.0000555
Further Details:      
 
Domain Number 3 Region: 794-914
Classification Level Classification E-value
Superfamily E set domains 2.1e-33
Family SVA-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000014848   Gene: ENSACAG00000015126   Transcript: ENSACAT00000015149
Sequence length 1492
Comment pep:known chromosome:AnoCar2.0:2:81152127:81252023:-1 gene:ENSACAG00000015126 transcript:ENSACAT00000015149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAALLIWALALLTCTASVISDSHYLVAFPAVIHHPGNEKFCVLLSSLSETVHLSVIIET
KIKNHTLLDKDVEKPGIYECPEFQVPPFVPEEESKPFSEEGDEVAHVHVLIQKGDSVSFE
KRKKVVIRKPKTRNIMEFDKPFYKPGQTAKLRIVRLNEEFKAIDETIPLIWLTDPSGNRI
GQWVDVKPHHGIVDLSFPLASEAILGTYTIKIGEGYREKRTFSVEEYVPHKFEVLFEAPE
LISTADENVQVKVLGRYTYGKPVQGKVHLKLTRDISYYFFEEELSGKLNAVEKHYTGQTD
KTGYASFTINATDLNLAQKGYSTQVALSAELEEDGTGVTLSGQKHINVVTRAIKVQFIDL
NPHYKHGFPYKGKMKFTVNGAPFKNETVYLTTDVNDVDRHLVYITDDNGEVHFSLDTTEW
KVFPVALRGRASLFNVTQYDASDFMTIFNEDFKWVKPFYSESNSFLEIRQVEEELPCGKD
QEVLVDYILDRKELDPEADHVDFYYLVVSKDRIVSTGQKQVQVGKDESLKGTFSFTLTSS
SDLAPKARLLLYAVFADGEVAADLEVFTVEKCFPQKVKVAFSEKEKLPGSKVNLDIEAAP
GALCSLRAIDKSVALKMNTTLTPEDVYSIYYDGDPVGTRGFMYHLEDFEPYPCLPSERRT
KRYFHAPWFQSQPDVYGLFQKLGLKMFTNTKVKKPVTCDLAVVERRLFRGGEPFPIAYSI
TQESPMPSNTVTREEEKSKPRTHFPETWIWNLVHVNEEGKATHPVTVPDTITEWNANAFC
VADIGFGLSQQASLRVFQPFFVEITLPYCVVRGESFQPKATVFNYLKDCIQVRVNLLETQ
EVEVKPCPACQFTTCLCAEEAKTFSWNVTATHLGHINFSITAEAEETQELCGNKISVTPS
QGRSDTVIKSLLVKPEGVPEEKSFNTFLCSSGDPMVDEVSLQLPENVVKDSGRATISVIG
DIMGAALQHIDHLLQMPFGCGEQNMVKFVPNIFVLRYLESVGQATSAIKERATEYMKSGY
QRQLLYKHDDGSYSAFGKRDAEGNTWLTAFVVKAFGHAKSYIYIEEKHIEEAVHWLKQHQ
HPNGCFQSVGKLFNNALKGAVDDDLSMTAYITASLLEIHLENEATLIDNALLCLKRNLSS
VSGTYTKALLAYVFTLAGDVETQQQLMKELDEQAERKAGIIYFPEVETMAYVLLAYLSMP
EVPTEKASQIVRALTPQQNPYGGFSSTQETIIGMQALAKYAALTYREIEDLKVVVKSGED
FQHEFHVDKKNQLVLQQTSLPAIPGQYHVEVSGNGCAYVQTTLQFNHQPEKPKVFDLSVT
TSPKECNQTSRKYFDILLQVSYIGERETSNMALIEVNMVSGFIPVKKSVKKLKNNTHVKK
VELDPDKTIIYLDELDRNVQSYHFSVEQEFEVLDLKPAIVKVYDYYHPGKRFTIMALYLF
TPVVLNLWVPRYFDLQISEILTAGKPAGISGSCRPKHLGTLRLRSTDLRNSL
Download sequence
Identical sequences G1KQP2
ENSACAP00000014848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]