SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000015210 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000015210
Domain Number 1 Region: 32-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-68
Family SPRY domain 0.00000000833
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000863
Family SOCS box-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000015210   Gene: ENSACAG00000015473   Transcript: ENSACAT00000015518
Sequence length 273
Comment pep:known_by_projection scaffold:AnoCar2.0:GL343404.1:631397:710596:1 gene:ENSACAG00000015473 transcript:ENSACAT00000015518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKISGSIKSVDVREPPYRPVKRELRGPDFCKPARLDMLLDMPPVQLEVQYKHAWNNED
RSLNIFVKEDDKLTFHRHPVAQSTDCIRGKVGYTRGLHVWQIHWPTRQRGTHAVVGVATA
EAPLHSVGYTSLVGSNNESWGWDLGRNKLYHNCKNQPGATYPVFLELDESFVLPDSLLVV
LDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEITMRYINGLDPEPLPLMDL
CRRSIRFALGRERLHDIETLPLPQSLKNYLQYQ
Download sequence
Identical sequences H9GME0
XP_003226762.1.98722 XP_008117850.1.98722 XP_008117851.1.98722 XP_016852505.1.98722 ENSACAP00000015210 28377.ENSACAP00000015210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]