SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000015597 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000015597
Domain Number 1 Region: 281-527
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-62
Family Nuclear receptor ligand-binding domain 0.0000000049
Further Details:      
 
Domain Number 2 Region: 175-254
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.89e-26
Family Nuclear receptor 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000015597   Gene: ENSACAG00000015814   Transcript: ENSACAT00000015911
Sequence length 555
Comment pep:known_by_projection chromosome:AnoCar2.0:1:1646467:1679450:1 gene:ENSACAG00000015814 transcript:ENSACAT00000015911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLCASSHKECSHLLPSLQDHGCSKTEVKSSLSELGSPAIPFSCSPSALTVEHSPIYIPS
SYMENRHDYSAMAFYTPAAMMNYNIPGNFSDSESTALRQTASPSMLWSGPGHISPLTLHC
QSSVLYAEQPKSPWCEARPMDHVLPMHREVLKRKASGSDCTSPTTNSPSSKRDAHFCAVC
SDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEV
GMMKCGSRRERCGYRIIRRHRNSEDSLHCVSKVKKTNETIIQMKEVLVNTLTPEQFVSIL
LEAEPPNVLVSRPNKPFTEASMMMSLTKLADKELVHMIGWAKKIPGFIELSLYDQVRLLE
SCWLEVLMVGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRLRELKL
QHKEYLCVKAMILLNSSMFPLPSTTEEPESHRKLNHLLNSVTDALVWVIAKSGIPLPQQT
TRLANLLMLLSHVRHASNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTVRNHRKTPISNLE
ISPSEQTETTDGMQL
Download sequence
Identical sequences G1KRR5
ENSACAP00000015597 XP_016846689.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]