SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000015684 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000015684
Domain Number 1 Region: 208-289
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.27e-27
Family PHD domain 0.00064
Further Details:      
 
Domain Number 2 Region: 345-693
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.44e-25
Family Hect, E3 ligase catalytic domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000015684   Gene: ENSACAG00000015893   Transcript: ENSACAT00000015999
Sequence length 709
Comment pep:known_by_projection chromosome:AnoCar2.0:1:26261634:26284288:-1 gene:ENSACAG00000015893 transcript:ENSACAT00000015999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEMEKPQGSNNLTCELCQRTDNCPEKYGKRTYEDYNLTVHYYCVLMSSGIWQRGEDEEGF
YGFLPEDILKEVNRAARLKCSICKKKGASIGCVASRCKRSYHLPCGTEKGCIFQFRGSFP
SYCWKHRPTQKRPSTAKGSSQCTICLELVEHAPSYNILTSPCCKNAWFHRECLQCQALSA
GVFFFRCPVCNNTEKFQSEMLRMGIHIPEKDASWELEENAYQDLLQCYQHCDVKRCLCRH
GRDYSEPDSKWEIKRCQYCGSSGTHFACSSLTSWEKNWECAGCRTILAESNGNIKKWRKR
SLSTAEKTDIGDGLREDPSPKWPRQSPGSHLGFLIRQLRVQKREVSNILRELRSQINIKP
TRLNINRQDIWNSALKGFQKRSFNPANTIEVNYINSRSEIKMYSCLSSKEDFFQLLTLHL
QNSSLFEGRFSKNLSFDSQALQDNLYYEAGKMIAVSLVHGGPSPGFFSKTLFCCLVYGPE
NVKPTVEDVADIDVLLTIEKIKSATTLSSLESAVSDCSEYLATIGCLKPITALGDKDILV
DEILNYHVIKRTLLPLESFEQGLKTLGVLEKMQMNPDAFCSILCHKPEKLSAKFLGDLFT
IYCLPGANKARSLDFWMGYLQETEGAESGVTLEDILLFATGTCSIPPIGFDPEPSVKFLH
ISCPIGKRHLNCLELPITKSYTKFKRTLDSSIRSVVVTTVGSRKHSVEY
Download sequence
Identical sequences G1KRW7
ENSACAP00000015684 ENSACAP00000015684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]