SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000016340 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000016340
Domain Number 1 Region: 62-506
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.15e-96
Family Integrin alpha N-terminal domain 0.000000000494
Further Details:      
 
Domain Number 2 Region: 807-1035
Classification Level Classification E-value
Superfamily Integrin domains 1.54e-62
Family Integrin domains 0.00000523
Further Details:      
 
Domain Number 3 Region: 507-665
Classification Level Classification E-value
Superfamily Integrin domains 2.3e-43
Family Integrin domains 0.0000116
Further Details:      
 
Domain Number 4 Region: 666-796
Classification Level Classification E-value
Superfamily Integrin domains 2.62e-34
Family Integrin domains 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000016340   Gene: ENSACAG00000016491   Transcript: ENSACAT00000016664
Sequence length 1083
Comment pep:known_by_projection chromosome:AnoCar2.0:6:18898759:19032889:1 gene:ENSACAG00000016491 transcript:ENSACAT00000016664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRLPPRRAISWRASARGSPRRRRRRRRRTREPPQRMGRRRRRWRGALLWLLLLLPPLG
AFNLDAEKRAVYRGPPGSYFGYALDFYSPAPSSHEVSILVGAPKANTTQPDIVEGGAVYY
CPWPATECKQIPFDGTNNRKIKVNGTREPIEFKSNQWFGATVRAHKGKVVACAPLYHWRT
LKAAPEKDPVGTCYVAIQNFSAYAEYSPCRNNNPDPEGQGYCQAGFSLDFYKNGDLIVGG
PGSFYWQGQIITSSVADIITDYSFKNILRKLSQEKQTGVAPSVYDDNYLGYSLAVGEFTG
DFQQELVAGVPRGAQNFGYVSIINSTDLTFIQNFTGEQMASYFGYTVAVSDVNNDGLDDI
LIGAPLFMEREFESNPKEVGQVYLYLQDSTLSFRDAQILSGTEVFGRFGNAIAHLGDLNQ
DGYNDIAIGAPFAGEERRGKVLIYNGASNGLNPNPSQVLSSMWASQPMPAGFGFTLRGDS
DIDKNDYPDLIVGAFGAGKVVVYRARPVVTVDARVLLSPEIINPENKTCQLPGSAALVSC
FTVNVCVAFEAPGVSDKIALKAELQLDSLKVKGAVKRTLFLDYHQSQHAFLLMIERQNWL
TCKDFVVYLRDETEFRDKLSPINVTLNYSLDESTFSDGLTVNPILNYYQENIVGKQAYIL
VDCGEDNVCIPDLKLSAVPDRDQIIIGEENYVTLIVNSRNEGEGAYEAELHIKIPPEADY
TGVERNNKALRALSCNYKMENETRTVICDLGNPIAAGANFSSGIRFTVQHFENAEFSIQF
ELQVRSSNKVNPNSNLVDLRLDINAVAQVQIRGVSHPPQIILPIHNWEPKDEPTKEDDIG
PLVEHIYELHNSGPSAINDTVLYVEWPVLSGEEFLLYILHIQTHGPLQCQTSSAINSLDI
KFSVPEDTPELAAFLRNSSIPHYVGRREAKAVEHQKNSARILNCTNVECLMITCSVGLLE
RGRSAALKIRSLLWASTFLKRKNGHYSLSVNVSFEVKKMPYKVQPAKLSEGSVAIKTSVI
WATPNISFAIPLWVIVLAILLGLLVLAMLTLALWKCGFFDRARPPRDDMADREQLTSDKT
TDT
Download sequence
Identical sequences G1KSU2
ENSACAP00000016340 XP_008110680.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]