SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000017993 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000017993
Domain Number 1 Region: 57-142
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.33e-26
Family SCAN domain 0.00023
Further Details:      
 
Domain Number 2 Region: 461-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.46e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 617-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-20
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 506-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 5 Region: 576-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.91e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 216-261
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000667
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 7 Region: 663-715
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000083
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 408-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000139
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000017993
Domain Number - Region: 342-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0299
Family Classic zinc finger, C2H2 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000017993   Gene: ENSACAG00000024511   Transcript: ENSACAT00000025558
Sequence length 722
Comment pep:novel scaffold:AnoCar2.0:GL343713.1:235184:246484:-1 gene:ENSACAG00000024511 transcript:ENSACAT00000025558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKEKSSSVLMEPRVKMEEPNQTSPEGGREPCTMWGRRSVRFPRRMGQDSLEEKAFSADI
QCQHFRHFCYEEALGPREVCSRLHVLCRLWLKPEERTKAEMLDLVLLEQFLAVLPAEMER
WVRECGAETSSQAVALAEGFLLSQAEEEKIQEKEPEGEILQAQEVPLETSQRFSSRWIKL
EEEEDTRPAPPGDEPSMLGRFNRSSLYNPAASLQWEQMTFEDVSLHFSKEEWELLDSDQQ
TLHWEVMEENYKMLASFGGPGQVSEYAPCKTWLKTEDCKDEEAENLRMEAEVYRGNQCAA
DIREITIQETIDESREIGNSLACENRFFHEASYPSDDIANHIEKGQPKCNQLEESFGSNI
HLTNYEGPQIVNKTYKRLGCGISFAEKRNLIAHERNNKGKCGNSLSCEYELKKHRNGHPE
EKSHICLQCGKSFHSIKYLNRHQKTHKGERPYKCPDCGKCFHLKGALNVHRRTHTGEKPY
KCLECGKSFYQKGELQRHQNTHTGEKPYKCLECGKGFADKRNLTGHERNHRGEKPYQCLE
CGKSYIFKAGLKTHQKSHIGECGKSFSCQTVYRNDTEEKSQTCLECGKSFRRRSSLKIHQ
RTHTREKPYKCQECEKSFHQKGDLDKHQTIHTGEKPYKCLECGKGFMQKRSLLLHEMNHR
GDKPYRCPKCGKSFNCQSVLKKHQNSHIEEKSHTCLECGKSFRWRASFKVHQKTHAGEKL
NK
Download sequence
Identical sequences H9GQ58
ENSACAP00000017993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]