SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000018099 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000018099
Domain Number 1 Region: 34-119
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.34e-27
Family SCAN domain 0.00025
Further Details:      
 
Domain Number 2 Region: 574-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 690-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.96e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 531-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 615-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-18
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 213-258
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000379
Family KRAB domain (Kruppel-associated box) 0.0043
Further Details:      
 
Domain Number 7 Region: 667-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000164
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 8 Region: 451-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000176
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000018099   Gene: ENSACAG00000027065   Transcript: ENSACAT00000027305
Sequence length 744
Comment pep:novel scaffold:AnoCar2.0:GL344037.1:22502:30440:1 gene:ENSACAG00000027065 transcript:ENSACAT00000027305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPNSRGPEAGPGGSGESWERTRHESLSVDLDSSDTQRQRFRQSSYQEGEGPRGVCSRL
HDLCRQWLKPEQHTKAEVLDLVTLEQFLSILPPEMGSWVRECGAETCSQAVALAEGFLLS
RAEDKEQEGQDGTDVGDKQGPAPSASFPTCSAPPSLPSDTTQSLRQKELKREGDGAAALQ
DYVVTSLELQGEIQGSHGDLLSALGRPHLKLHCVQDVAVDFSLEEWVLLNPDQKALHKQI
MEEMNGIVASLGKAPSLMGFLFQKLKWEDFHNWSQVKVSRRGIEQPSNSAPLLQVKHSVY
LFHPKCIGIRAEQRDSRQNDISKKSQDFVRKLIVEHSAHNEQSKELSVCETEAFMKKKFK
NLLKLKTGDQMLNCDETGLSCKVLPNSTLSPRGDSGQITIHVSLCNSIFIISETLLYSEI
REHGKRELGLGERKKKEGRMVKWVVVDNGEKSHVCTKYRKHLGHNWGLRQQQQAHREDGG
SAKERPDKCSVCGRCFTQNMALVLHKTLDVGKSHLKGKVSAKCVVKHKKFHTGQEPYRCQ
ECGKCFASSSALLSHKRLHTGEKPYQCQECGKCFADSSALVSHKRLHTGEKPYKCQACGK
CFASSSTLVSHKRLYTGEKPYQCQECGKCFTSSSTLVSHKRLHTGEKPYQCQECGKCFTD
SSALLNQECRKCFADSSTLVKHKRLHTVGKPYQCQECGKCFASISDLVRHKRSHTGEKPY
KCHECGKCFTRTSSLNQHQRTHTG
Download sequence
Identical sequences H9GQC0
ENSACAP00000018099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]