SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000018320 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000018320
Domain Number 1 Region: 62-161
Classification Level Classification E-value
Superfamily Virus ectodomain 8.34e-25
Family Virus ectodomain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000018320   Gene: ENSACAG00000024222   Transcript: ENSACAT00000024040
Sequence length 216
Comment pep:novel chromosome:AnoCar2.0:1:157882361:157883053:-1 gene:ENSACAG00000024222 transcript:ENSACAT00000024040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPGLYWICGKWAGKILPLFWTGTCTIGTLFPATPPPEEVSESTRKKREYDEKYGFDPDN
TYLTEWERLAVILFPSAGVAVNVRQIRRLSAQLERLANQTVAGMKALQEEVDSLAEVLMQ
HKLALDYLLSAQGGLCVWLNTTCCHYVNESGEVESDIVKINKVVSTIRTGYSAAGEGPFH
WLTSWLPDMNWLRGLFVMGFIVLLVILLAMLLIPCI
Download sequence
Identical sequences G1KV75
ENSACAP00000018320 ENSACAP00000018320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]