SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000019484 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000019484
Domain Number 1 Region: 355-488
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-40
Family C-type lectin domain 0.00021
Further Details:      
 
Domain Number 2 Region: 926-1068
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-37
Family C-type lectin domain 0.00046
Further Details:      
 
Domain Number 3 Region: 789-919
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-36
Family C-type lectin domain 0.00052
Further Details:      
 
Domain Number 4 Region: 499-638
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-34
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 1076-1205
Classification Level Classification E-value
Superfamily C-type lectin-like 1.64e-31
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 6 Region: 230-343
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-29
Family C-type lectin domain 0.00075
Further Details:      
 
Domain Number 7 Region: 635-774
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-29
Family C-type lectin domain 0.00015
Further Details:      
 
Domain Number 8 Region: 1223-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 5.91e-29
Family C-type lectin domain 0.0005
Further Details:      
 
Domain Number 9 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.02e-27
Family Cysteine rich domain 0.00031
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 2.57e-16
Family Fibronectin type II module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000019484   Gene: ENSACAG00000026180   Transcript: ENSACAT00000023278
Sequence length 1447
Comment pep:novel chromosome:AnoCar2.0:6:17965812:18008887:-1 gene:ENSACAG00000026180 transcript:ENSACAT00000023278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVLLLNLLFLIQPTFQASESDTFLIHNERLNLCIQAQKSRSIILNSCNKDNEWQNFKW
ISEHQILNMAVKLCLAVPSKTNLAPLTVSPCNQTNELQRWTCRNESFLALGEENLFLQPS
GGQKDILVLSKITTMKSTWKIYGTKDSLCTKGYETLFTLEGNAFGAPCVFPFKYINRWYA
KCITDDDDNSRLWCGTTADVDKDSLTGYCPVKGDHDEFLWTKNHWTGDLYQINSHSALTW
FQARKSCQQQNAELLNIKELHEQTYLTGLTSNINTDYWIGLNSLDLDSGWEWAGNHPFRY
LNWASGSPSPESEKLCGSMQSKNGQWVNNKCDQKLGYICKKENSSSDSSVIPTDGFKPIQ
CQGGWTAYAGYCYYLNRALKPWRDALSSCRKADGDLVSIHNLEEYSFVISQLGYKPTDLL
WIGLNDQRTAMYFEWSDGTPVRFTKWQRGEPTHVNNVQEDCVIMSGENGYWQDYFCEEQL
GFICKRKPLASEVSEEVETDDPKCHKGWKRHDLYCYFIGQTTKTFSEAKTFCEAAKGFLT
SVEDRYEQAYLTSLVGLRSERYFWIGLSDIERPGTFNWTNGDKMSFTHWNSEMPGQSPGC
VAMRTGMAAGLWDVVDCKEKAAFLCKQWAKGVTPPPVPPVTDAPSCPDGWTPSPTRSVCF
KAFIQGKYLKKTWFEALDFCKEIGGDLPSIHSQEEQDKIEELLDSEHSWIGLNNLDPEKG
LVWSDGSPVDYNNDMFASFSHRNMERGCKIIQDYFGIWSTILCYHLNMWICQIQRGISLK
PEPKNTFEYSFKIVEDGWVAYESNEYYFSNFTLPAEKAQAFCKKHGGKLTVIENENERKF
LWKYNYFRGSQYNCYIGLILGMDGKFGWIDGSPVTYAAWAPNEPNLANDDEHCVVMYSST
GLWNDINCGAENGFICKRHNSSVAATVVPTSPEPLGGCAEGWLLFDNKCFQIFGFHEEER
KNWSAARTHCKSQGGNLASIPSKAVQAFLILLLKSISTEAWIGLNDINQEQSFLWTDGSG
VYYTNWDNIPLRFDSDCVFMMKMPEKLVGKWRDGNCNHEKSYVCQRKTDTMLPYLETTLP
SSGYTVYGNSSYSVVSPKMTWEEARKKCKSENSELASILNPYVQSFLWLQVLKYKEPVWI
GLNSKLTNDQYKWISGWRLMYTAWAAEEPKEKTACVYLDLDGHWKTSPCNETYFSVCENY
HGIIPTEAPELPGRCPESKESHRAWIPFRAHCYSIYQIRTSWAGASMRCFHLGGTLASIE
DIAEMHFLLEHTHQFTDMSFWIGLFRNVEGEWIWLDNTELDFVNWKNEPPETQSSYFHSY
DGRGDIRFLDQCIFMNGHNGEWNGEGCNYPQRGFICKTPKILNEQTEQRTNDKEQAEVPA
QPHGTTVIVVFLAMLILMGAGVAAYIFYKKQRKQQQNAAGFNNSLHEDNVIILQNDKELL
VNNKAGD
Download sequence
Identical sequences G1KWP1
XP_016849791.1.98722 ENSACAP00000019484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]