SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000020419 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000020419
Domain Number 1 Region: 61-146
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-25
Family SCAN domain 0.00028
Further Details:      
 
Domain Number 2 Region: 640-696
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.56e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 527-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 681-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 583-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-20
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 8 Region: 379-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 222-261
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000745
Family KRAB domain (Kruppel-associated box) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000020419   Gene: ENSACAG00000026399   Transcript: ENSACAT00000024493
Sequence length 776
Comment pep:novel scaffold:AnoCar2.0:GL343575.1:72152:88611:1 gene:ENSACAG00000026399 transcript:ENSACAT00000024493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEQHISLAMLGTAWEKRIKMEKPDAACYELGEGLDPVQTEHKRELSGKTIEKNLGEDA
LSPDVLHQRFVQFEYQEALGPREVCSRLYALCHQWLKQEEHATAQFVDLVVLEQFLAILP
PEMEDWLRDCRPETPCQAVALAEGFLMSQAEKKTQQCSTEQEMDEVEKCPLEPRQTLHPA
WMVQDVNGESISINVEITAGPPCPSTSLNVDKSIAAPARLNQVTFEEVAVYFTDEEWAML
DLGQRTLHCEVTEEILGMMMSPAGDGRLSENEGETCRLLSERATYKQTEENGRNEKSGDK
ALAQGAESSGISVKDKTGDEKECIYLPCGRSISCKTSLHCRKESSEGEMLFKGGDYGEIA
SVWKGLISHQTMPMDPVSFKCLECGKSFSEKAQLTSHQAVHTGEKPFPCLECGKSFTQRS
ILTRHQTIHTGEKPFGCLECGKSFGQKADLTRHQAVHTGVRPYKCLECGKSFSQKADLTC
HQRIHTGEKPFKCLECGKSFSQKANLIGHKTTHTGEKLFKCLECGKSFSRKTNLTCHQAI
HTGEKPFQCLECGKSFSQKTNLLGHQATHTGEKLFKCMECGKSFSRKTHLTCHQRTHTGE
KPFECLECGRCFSQKSLLVHHEATHTGEKPFHCLECGKRFSQKTKLTYHLKMHRGEKPFK
CSECDKSFGQKSLLVRHQAVHTGEKPFKCSECGKSFSQKIDLTRHQIIHTGEKPFQCSEC
GKSFSWRKSLTAHQAATNHWNVSDVEIVTVGDDAIFDTKEFVHMNVESPPIIARIL
Download sequence
Identical sequences H9GU03
ENSACAP00000020419 XP_016853272.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]