SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000021578 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000021578
Domain Number 1 Region: 79-170
Classification Level Classification E-value
Superfamily Virus ectodomain 6.12e-23
Family Virus ectodomain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000021578   Gene: ENSACAG00000026541   Transcript: ENSACAT00000027624
Sequence length 240
Comment pep:novel scaffold:AnoCar2.0:GL343309.1:1272278:1274483:1 gene:ENSACAG00000026541 transcript:ENSACAT00000027624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPGYFWICGKWGGKVLPPLWVGTCTIGTLVPTNIEIHPREQPLQALGATDRWNRPKRSY
DEKRGYNPDNTYLNEGERFGAILFPWVGAALNVKQLRRISAQLEIMANQTVFGIKALQTE
IDSLTGVLMQHKMALDYLLAAEGGLCVWLNITCCHYINESGVIESDVAKINSVVFTIRAK
YTPKGTGWIDWLLNFFSGYLVAEGPHQNIDIMCLCLNIVLSGFTAIMISNLCLETPMTDT
Download sequence
Identical sequences H9GVW1
ENSACAP00000021578 ENSACAP00000021578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]