SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000021835 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000021835
Domain Number 1 Region: 42-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.7e-25
Family SCAN domain 0.00045
Further Details:      
 
Domain Number 2 Region: 643-699
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.08e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 587-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 503-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.09e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 684-736
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.05e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 200-241
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-16
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 7 Region: 464-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000103
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 434-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000317
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 9 Region: 549-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000341
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 400-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000117
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 11 Region: 342-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000506
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000021835
Domain Number - Region: 315-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0751
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000021835   Gene: ENSACAG00000029040   Transcript: ENSACAT00000029253
Sequence length 751
Comment pep:novel scaffold:AnoCar2.0:GL343532.1:23368:31793:-1 gene:ENSACAG00000029040 transcript:ENSACAT00000029253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDQDQVYHPLGEGLYAGQTQDGRNLLGRAMQRSLEENMLHLDAQHQDCKPFSSQEALRP
RELCSQLHRLCCQWLKPERCTKAEMLDLVVLEQFLAILPTEMECWVRECGAETTSQAVAL
AEGFLLSQKENREQDWFLERMAEMEKCPSKSSQRQQAKWLMRDQEEKSSTMRREIRTGPE
CKSAFLSHDELRRTSARPYQVTFEDVAVYFTEEEWALLNPGQKALHWEVMQENLGVLFSL
ASDGEMDQYKGESCQTLLQRDHCKQLNETERETDTKGMWRSKPIQKDICGTSVQEIMRKE
MERNKHFSLAFESNFSPKASLNLHRKTQPREKSFEGGECGNSSSLTSFDNIHIREGPFQS
FNCGSNFRLSSQLLTDLRTHTDGRTLKCLMNEKSFLSYCYQKVCTDGKQSTCLDCGKSFI
KKMQPTCHQATHNGEKSFNCLDCGQQCIWKDHISYRQAIHGAEKTFKCLECPKGFSRKTD
LTYHQATHNGTKRFQCLECGKGFLWKAHFSRHQAIHNGQRPFKCLECGKSFIRKTDLTFH
EATHTGEKPFKCLECGKAFIRKTDVTRHKIAHVAEKPFKCLECGKGFIWRRHLIRHQAIH
TGEKPFTCQECGKGFIQKIALTRHQAAHTGEKLFTCQECGKGFVWKTHLTRHQATHTGDK
PFTCLECGKSFIRKTHLTRHQGIHTGEKPFKCLECGKSFSQKLNLSHHQITHTGEKPFKC
MECGKGFSRKAHLGRHHATHTEQKDQEVYEY
Download sequence
Identical sequences R4G9E0
ENSACAP00000021835 XP_016853105.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]