SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000021894 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000021894
Domain Number 1 Region: 57-143
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-25
Family SCAN domain 0.00031
Further Details:      
 
Domain Number 2 Region: 676-732
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-19
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 773-825
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-18
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 731-788
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 619-676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 563-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 353-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 509-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-16
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 10 Region: 452-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000119
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 209-253
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000994
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 12 Region: 321-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000028
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000021894   Gene: ENSACAG00000029491   Transcript: ENSACAT00000029312
Sequence length 892
Comment pep:novel scaffold:AnoCar2.0:GL343312.1:1234201:1246045:-1 gene:ENSACAG00000029491 transcript:ENSACAT00000029312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKGRGSSVLMEPRVKMEEPNSYSPEGGSEPNKLWGRRSAELWQRMGKDALDEKTFSSDV
LWQLFRHVHFQEALGPREVCSRLHSLCRLWLKPEEHTKAEMVDLVLLEQFLAVLPAEMER
WVRECGAETSSQAVALAEGFLLSREEEERQEREVLQAQEAPLETSKKFSSGWIELEDNTG
ESLLGDEPRMVGRRNSSSLCGEGDMASVEQNQVTFEDVAVTFSDAEWALLDPDQQVLYKE
VMDQNVKMVVSFGGDGQGSKNGQVPCEGWLQTDRCVEENITTEAEESRRSQYLATSDDIR
EHIEQAQLKSHQSEEIFEFSKHFPNHEKYNHHYPYKRLDCGKSFHHNKVLSRHTGVKPYK
CLECGKAFIYKTSLVGHEMNHRGEKPYKCLECGKSFSFKSVLKNHQDRHKEEKPYTCLQC
GKSFHRNGDLSRHQKTHTGQKPYKCLECGKCFTEKRSLIRHGVMHRGEKPFQCQECGKVF
NYKSRLKSHLNSHIQEKSYTYPQCGESVSCKSVLKNRQDRQTEEKPFKCLDCGKSFHHNG
TLSRHQKTHTGEKPHKCQVCGKAFIDKTSLVGHEMNHRGEKPYQCLECGKSYSFKSVLKN
HLDRHTEGKPYKCLDCGKSFHHNGDLSRHKKTHMGEKPYKCLECGKGFTKKRSLLQHGMT
HGGEKSYQCLECGKGFNCESHLKRHQNSHTEGRPYTCLYCGKSFNHNGTLIRHQKTHTGE
KPYKCLECGKSFIDKTSFIGHEMNHRGEKPYQCLECGKSFSFKSVLKNHRDRHTEEKPYT
CLQCGKSFHRNGDLSRHQKTHTGEKPYKCLECGKGFSQKRSLIGHEMNHRGEKPYKYQES
HAKEKSYSYLLGDLVEAIPCADSSTETCTFPDDNLCCASPCSDAGETFKFIL
Download sequence
Identical sequences R4G9J1
ENSACAP00000021894 XP_016851847.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]