SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000022216 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000022216
Domain Number 1 Region: 42-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.7e-27
Family SCAN domain 0.00027
Further Details:      
 
Domain Number 2 Region: 362-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 502-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 446-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.56e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 543-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-20
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 323-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 7 Region: 191-243
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000209
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 8 Region: 408-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000129
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000022216   Gene: ENSACAG00000028283   Transcript: ENSACAT00000029633
Sequence length 607
Comment pep:novel scaffold:AnoCar2.0:GL343575.1:272739:281117:-1 gene:ENSACAG00000028283 transcript:ENSACAT00000029633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRPDSAGPEAGNVLEGLSAGNKGRFWARPMLKFLGDNFANSDTQPHHFGQFSCEEVEWP
REICSQLHHLCRQWLKPEKHTKNQMLDLVVLEQFLTLLPSKMSSWVRECGAETCSQAVAL
AEGFLLSKEAEEQDEEQQAKKLSTDIQPDFSAVREAPSDARQNSQQRDITLQGAEAIQGT
MALGYNGAGLFQVPVTFEEVAVSFLPEEWGFLNADQRALYNEVMEETCSIMSALGNWKGK
NAFANHRNPHTQIFPKHEEACIEEKCPEEMSCICTNCGRCFTPNTIHVCDERMQQEENHF
GYEILVKGVDCKLQHERYHIAEKAHKCQECGKCFASKSHLRQHQAIHTGDKPYSCQECGK
CFISTSGLLRHLRTHTGEKPYRCQMCGKCFVSNSVLLIHQRIHTGEKPYKCQECGKCYAH
HSGLVVHQGMHTGEKPHNCQECGKCFHSRSGLLKHQRIHTGEKPYKCQECEKCFLSKSSF
VDHKRVHTGEKPFKCQECGKCYARNSVLIIHLRTHTGEKPYGCQECGKCFNSKPELLNHQ
RIHTGEKPYKCQECGKCYARKPDLVIHQRTHTGEKPYSCEECGKRFSSKSCLVIHQKIHQ
KYSTYST
Download sequence
Identical sequences R4GAC2
XP_008119839.1.98722 XP_008119840.1.98722 XP_016853277.1.98722 ENSACAP00000022216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]