SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000022236 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000022236
Domain Number 1 Region: 42-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.89e-27
Family SCAN domain 0.00014
Further Details:      
 
Domain Number 2 Region: 623-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-19
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 3 Region: 668-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 566-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-18
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 420-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.08e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 528-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-16
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 458-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000116
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 8 Region: 197-238
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000262
Family KRAB domain (Kruppel-associated box) 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000022236
Domain Number - Region: 370-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0243
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000022236   Gene: ENSACAG00000029526   Transcript: ENSACAT00000029653
Sequence length 725
Comment pep:novel scaffold:AnoCar2.0:GL343575.1:98974:105544:-1 gene:ENSACAG00000029526 transcript:ENSACAT00000029653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRHYVGPSRGKGPLPVQVKRRRTFRGKTAQKIPGKDVLHLERLRRSFRQFCYEETEGP
RKVCSQLHHLCSQWLKPEQHTKAEMLDLVVLEQFLAILPAEMERWVRECGAQTSCQAVAL
AEGFLLSEAEEKENEQQDVLVEDLANATATESSSETNSAMPEKERVITSVEERTNMQSTH
VNPSPDFGALHGASVDQVDCDELAVDFTEEELPLLDPDQKELHREAMEENFRLVISLDGD
DDDDGGGDGGDDHDEQLEKEEGGPSEDLFKRVKCEENEPKGRKSVSDGKRKDTSASQGQE
EQSEENREEPNRELLKSVKCKQVKLKERSPNAPGKKRKKTSAPKGAESSEIPPSEKNTKR
KAKNRNIQLLCEKCFNCKQNLDSHEETDTGEMSSKDGECRRSPRVSKGRISHPVNQKSPK
PFECSYCGKSFAKERLLTCHQATHTGEKPFQCLECGKSFPQKLLLTFHQKTHLGNKRFTC
LECGKSFLWKWSLNSHQESHKGKRSFKCSECGEILSWKARLRQHQVEKTFKCLKCGKSFR
QKAHLTRHQVIHTGKKPFQCLECGKSFTWKVNFTSHQRAHTREKSCKCSGCGKNFKQKAR
LARHQVTHTKEKPFQCLECGKNFSWKTDLTRHKKLHKGERPYTCLECGKSFNQKTHLTCH
QSVHTGLKPFQCLECGKKFSQKTHLIRHERAHTGERPYECPECGKGFTRKDVLSCHQKIH
TGGTR
Download sequence
Identical sequences R4GAE0
ENSACAP00000022236 XP_008119834.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]