SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000022300 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000022300
Domain Number 1 Region: 61-142
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.1e-24
Family SCAN domain 0.00032
Further Details:      
 
Domain Number 2 Region: 698-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 417-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 754-810
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-18
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 5 Region: 530-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.06e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 6 Region: 642-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-17
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 474-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 217-262
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.76e-16
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 9 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000126
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 379-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000436
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 799-839
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000818
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000022300   Gene: ENSACAG00000029263   Transcript: ENSACAT00000029717
Sequence length 854
Comment pep:novel scaffold:AnoCar2.0:GL343713.1:199537:214231:-1 gene:ENSACAG00000029263 transcript:ENSACAT00000029717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKGRGSSVLMEPRVKLEESNQTSPEGGREPNEMWDRRTVGSPGRMGQDALEEKAFRANL
RYQRFQGFHFQETLGPREVCSRLHSLCRLWLKPEKHSKAEMVDLVLLEQFLAVLPAEMER
WVRECGAETSSQAVALAEGFLLSRAEEEKALQEEQKEREDLQAQEAPLETSKTFPSRWIK
LEEEEEDTRAAPPEEEPRMLGSHNGLSVCEAGETASMEQDQVTFEDVFVHFSEEEWALLD
PDQQALHWEIMGENYKMLASFGGAGKESENGTASYKVWFKPAEYIEGEEGNLETEREDYR
RKECSASMRENTVQETVDESREIRNCLVLETNFLHEDSCLNGDSTIRIEKGQPQCHQQEE
SFGSSIHLRNYEKPQIVAKLYKCLECGKGFSEKRSLIGHEMNHRGEKPYMCLECGKSFSL
RERLKLHQNTHRGEKPFKCLECGKCFFQKGNLNKHKRTHTGEKLYKCQECGKDFSERRSL
IGHEMNHRGEKPYKCTKCGKCFHLKGVLNKHQKTHTGENIYKCLECGKGFSEKRSLIGHE
INHRGEKPYKCLECGKSFCWKRSLKLHHYTHMGEKPYKCLTCGKSFVENRNLTRHEMTHR
GGMPYKCLECGKCFHHEGVLNTHQKTHMEEKPYKCLRCGKHFFHKGNHKRHERTHTGEKP
YKCLECAKGFSDKRSLITHEMNHRGEKPYKCLECAKGFSHKQSLIAHEMNHRGEKPYKCP
ECGKGFSDKRSLIGHERNHRGEKPYKCPECGKGFSGKRSLIGHEMKHRGEKPYKCLECGK
GFSHKRSLIAHEMNHRGEKPYKCLECGKSYSLKSILTTHQNSHTRECGKRFGFKSDLKNV
QNTLIEEKSKTSLD
Download sequence
Identical sequences R4GAK1
XP_003228799.2.98722 ENSACAP00000022300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]