SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000023201 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000023201
Domain Number 1 Region: 340-430
Classification Level Classification E-value
Superfamily Virus ectodomain 0.00000000000000361
Family Virus ectodomain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000023201   Gene: ENSACAG00000029078   Transcript: ENSACAT00000030621
Sequence length 514
Comment pep:novel scaffold:AnoCar2.0:GL343727.1:87146:88690:-1 gene:ENSACAG00000029078 transcript:ENSACAT00000030621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLIPSGATERRWSSMSQHGPTKALSGRWWLDILRGKSGRQVMRRGGKRTVFGILFVLSF
IFSFGKRAHGNWIKEHANYMFEQHGKEVALIYEHPLTVGDFSFLPDLIDEPQIVLEGLSK
AQEGPPTVFSSIPQRINKTRFRRFRYHTSTRGLCFCCGGSGIWNSEWKHWGTRQAFFSRL
GNYSHCRDRFYLHGRFNTSYVSRLNLTATEWASMYPDYPTFSVNDSIEGLKSYMNILQQL
TQLSLGKSLCPLWQIRDPNLWFFFDKWATNYHPGNYQCVGVGYLTFPVQVLHKGHQRLKR
DIVQTGPLGPECSDEVIINKALSGSEASRVGGGLITGLLTLGAYPGIVAQANRRSVLGLT
CRLEKSINATGKIFREIQSEVEEISQMALQHKLALDYLLAARGGLCAMVRGRCVVKFHNL
NNTIEDDIESLQKLIYNNVQEIEGWSPFSWVTSWLPSIEWLKNILLVGILGLFIVLIVMC
CTPIMMQMCTRCVTQSLPEKKIAILQAKRDWMEP
Download sequence
Identical sequences R4GCX4
ENSACAP00000023201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]