SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000023254 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000023254
Domain Number 1 Region: 906-1005
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000847
Family Dystroglycan, N-terminal domain 0.0094
Further Details:      
 
Domain Number 2 Region: 64-156
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000408
Family Dystroglycan, N-terminal domain 0.0038
Further Details:      
 
Domain Number 3 Region: 181-300
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 0.0000549
Family Dystroglycan, domain 2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000023254   Gene: ENSACAG00000028818   Transcript: ENSACAT00000030673
Sequence length 1278
Comment pep:novel chromosome:AnoCar2.0:5:91047725:91062568:1 gene:ENSACAG00000028818 transcript:ENSACAT00000030673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYYVRMDVPASHTGACGIRFDFLPERQILTALTLLFSLLFLTTITSDVIAKESRNICEE
IQILQGVQDATAVIGRIFFYPISPFAFQGKISHYKVTLANGSALPKWLEYNPNAKTLQGL
PLLEESGKYHLAIFAYGDACSQKTPAARANFQLHVQESHLANNTATDPNQKCNSVGSGAL
CVKDISVTFAEIIISAPNTLEIRERLYLICTMADYLHLDPSLLTLTTFSNHLRNLTVLAE
DIRYTNPTKQHSVGIYWPVGFGVFAMMHELIQVLQHNVESNSLSQLLGFEISGWRVLKKE
SNGKKHSKQRRRRYLMATPRPVLRPTSVETFTHLSHTLTQSIVKPIKSSSLLYDVIPTYT
DAFLHSVINQKDLQTTDLEVLLNVQTQALASPMFQDVSSELLPSLMSASTELKVVSQTPP
ISELQPQVPQDIYSTFKKSEPDHDSTLYDSVFLMPVRKTQLSSPFHHIMDTCLSPQVISS
GKRSSLECSSRETTDQDYNDLCKQTALHLLSEDTLLKVKLALPSIPSTDLTASSGFPCLS
IIMSLLLSDGSYDNEGLLSNYKYATELFLSSPAFNQNTGFSMFGITSMFETTARSTTFAL
KLELLPNTSSSVQTYYSGKIQTLAIYSAQELRTSLFANFMESGLLTTTSSILAKFSSQSL
YPPMELTASFGLNNIFLVEELWSNGRQHRPAVTQVYEHAPESFMISQTHTHLITKYNISA
ITSIYLETFLQQQQLHFFSVTGSNNILLSSKFIGKEEETKQISENYSYETSVLASPIEFA
SSPKLDVSVNEYGFYDGNVVTTLFAHHDFLQLHMSVSSLESSFETKRNIQVASESLTTPV
QESTLLSNKEMPAQNGFYATTLCQGAEDTNILTLASDMSPQGIGAIRTPLFPTSQIMPID
QINNSPRVVNALKWITATIGYKFFFSIPEDTFYDQEDGNTTQLTLGIIPTGGSPTGLESW
LQFNSSYQTMYGYPLDIDFQYSPQEFLLFATDSGGLRTSNTFTIEMLRQSTTPCHIYTVR
TKNSYHSFLRNRENVNLFFEKLSNYLTTGRSGNMVILHLKPGSTRITWYSESFCTTTSNC
ARDEIQDVLLQLGVPGRKLNPNFVEAMLPDYKIYQIEDVEYGGTCSSTIKQLNESLVSNK
TLTTFQDYCSWVGNLFSILLIGICTAVLVILIVTLHFCKYQKGTVGSQSASVNERPLFTY
IDLEMDMLRPRKSPVLDQEAPQSAQLWLSLPPPSHSYFCRSNTTHVASSLPPPPRYKLPP
PYVMKEPSQMHHDFSYRF
Download sequence
Identical sequences R4GD17
XP_008109683.2.98722 XP_016849445.1.98722 XP_016849446.1.98722 ENSACAP00000023254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]