SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374287299|ref|YP_005034384.1| from Bacteriovorax marinus SJ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374287299|ref|YP_005034384.1|
Domain Number 1 Region: 79-245
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.96e-24
Family Prokaryotic proteases 0.0044
Further Details:      
 
Domain Number 2 Region: 390-492
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000968
Family Collagen-binding domain 0.003
Further Details:      
 
Domain Number 3 Region: 273-376
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000262
Family Collagen-binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374287299|ref|YP_005034384.1|
Sequence length 494
Comment putative lipoprotein [Bacteriovorax marinus SJ]
Sequence
MMITSLKCLPKNLLLLTFTFALVISCGKNDETSSSDPALFDSQIIIGSVDWKEISDLSTT
NSIRKASSPVADVTLPVMGSRCTGFLISEDVLMTNEHCIPSAAYAEGVTASFRHLKGVSE
SNWEEYDCSTFLMNNAEFDFALLKCSGSPGRKFGFVEIDSSHKSTGTSVYIVQQNCDYYS
SRNCDWTKKYSKGSITEVADEYTHNADTLGGSSGSPMFDASSHKVVGLHHAGLGNNGMGR
GYENYAVKMSEIVPVINARFPSLLGGGTPSSGDQTEDNNTLSKAFSLKGSSETLSGLSVE
SSDDLDYYSLKAARGAQVSVSVKFSHSKGDLDVYLVNSSGGVVKKVESSSDNEEFSYVST
GEKVYFVVFGYKGAVNTYKMHVTVSSQNVENDSFETAKALDTNHSEDYSLSKNENDFFSF
EVSRTSSVSVKIEFTHSRGDLDMKIFDKNKKVVASSLSTKNVEEVTKSLAKGKYYVQVYG
YKGAANDYSLTIRD
Download sequence
Identical sequences E1X4I3
WP_014243200.1.66676 gi|374287299|ref|YP_005034384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]