SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374290038|ref|YP_005037123.1| from Bacteriovorax marinus SJ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374290038|ref|YP_005037123.1|
Domain Number 1 Region: 28-170
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.47e-20
Family Nuclease 0.011
Further Details:      
 
Domain Number 2 Region: 238-401
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.59e-19
Family Nuclease 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374290038|ref|YP_005037123.1|
Sequence length 478
Comment hypothetical protein BMS_3427 [Bacteriovorax marinus SJ]
Sequence
MKLISIILFTLLSLSSFADTKFYSKFSPHEGAQAFEIIYKEVKESKKYVYATIYSWSDKG
ITDSFKEALQNGVEVKIILHPSLAKKSSIKKVASELEALGADLKIAKMNMHEKFVLVDDV
FVVNSSANMSGGAKNRYSENFIYHSDETVEGKSVLSQFKKEFIILWNSAKDIFTANEGIA
EKLNLEALSNSPINSNASLYSSSMNFKIKENKPSSKAYKQGKYYTLSRIGGVKNQTWTVR
DIILDNIKNAKSNIYLSLNHFNIREISDALIEAVKRGVDVKLAVDNQEFKTRINNKEMTP
QFVSDWKALPGNKSKIAPVRVKYYSHSPSPRHWLLNHHKFIIVDYNESNFEETKLISGSY
NLSKTAEHNQFDNMVVYKSVANKALFKSFKEEFDNQWFWNRDSSDKPKKEMIEQFTNLKD
GTSIALHMKEAVSLNWKEVLSLRSKVSRAAKGFFRGLYSNKDCLYYDVTKSSFWGCPR
Download sequence
Identical sequences E1X1K1
WP_014245938.1.66676 gi|374290038|ref|YP_005037123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]