SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17227770|ref|NP_484318.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17227770|ref|NP_484318.1|
Domain Number 1 Region: 259-399
Classification Level Classification E-value
Superfamily CalX-like 1.83e-24
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 2 Region: 88-244
Classification Level Classification E-value
Superfamily beta-Roll 9.29e-23
Family Serralysin-like metalloprotease, C-terminal domain 0.00078
Further Details:      
 
Domain Number 3 Region: 2-129
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000488
Family Serralysin-like metalloprotease, C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17227770|ref|NP_484318.1|
Sequence length 826
Comment hypothetical protein all0274 [Nostoc sp. PCC 7120]
Sequence
MIINGTSGIDELYANKDNQVFGWEGDDILDASNGEGNNLLAGGAGSDRLFANNNDTLKGD
AGEDYLYALGSLGFNTLEGGDDNDQLFIVEGGNNTLDGGQGSDRLIVLDGSGYNTLSGVL
GNDLLDVSNGTGNNILYGNEGDDVLIGGVNTDQLFGGAGDDLLFGGRRGSQLTGGTGADR
FFLTSAAVPEIPIEVLDFTKNDDKVLVAGIPEVRTFQDLQLQQTGADTVVKARINNIVRE
LGILRNIQANTLTPDDFDYTTAIFSITNSSATEGNSITFTINRTADTQTQQTVTVSTSIT
TGDTASNTDFVAKTQTLTFQQGEIQKTFTVETTQDFLVEENESFTVSLSNPTNGAILSPT
AATAKGTINDDDNAGVIITQTGNNTIVTEDGTTDSYAIVLTSQPVSDVIINIRNGQQIRT
NPRTLTFTTENWNVAQNVTVRAVDDFLVEGDGNETISHTSTSNDINYNGIIIDPVAVAIT
DNDIPLFQNPNSDIFTIKGNSDKVNLQVTLTKRNSNFTNELSVFTVDDANGTINGIAPGA
AGYTEAALQRARVIFSAIAKNPNGFNPNNLASLLEFDSGDNLRFYVVRNSSTDAVLAGVT
PISNVVLANSSTQKITNLGTDGFSLGWEDGFGNSSGFEDLVVKIQTTNQILPLGVNLQSQ
AQGELIDLRGVTQLVKADFVVNRDAAFNNFIGFYQVTDENGGIDTNGDGSADILPGQSGY
TQAAIRGRVPGIDLVVNNRGTATYTGTFQPGSLFAPFIIINSRPERILDNNPNNDPAVYF
PFLGANRNRVDHIRLLANNVFGFEDLPNGGDQDFNDMIVRVNLSIA
Download sequence
Identical sequences A0A1Z4KQI8 Q8Z029
WP_010994451.1.33676 103690.all0274 NsR120 gi|17227770|ref|NP_484318.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]