SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17227771|ref|NP_484319.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17227771|ref|NP_484319.1|
Domain Number 1 Region: 178-550
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.33e-74
Family Glycerophosphoryl diester phosphodiesterase 0.0000135
Further Details:      
 
Domain Number 2 Region: 803-1022
Classification Level Classification E-value
Superfamily beta-Roll 7.43e-28
Family Serralysin-like metalloprotease, C-terminal domain 0.00062
Further Details:      
 
Weak hits

Sequence:  gi|17227771|ref|NP_484319.1|
Domain Number - Region: 42-161
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00113
Family SGL-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17227771|ref|NP_484319.1|
Sequence length 1027
Comment glycerophosphoryl diester phosphodiesterase [Nostoc sp. PCC 7120]
Sequence
MVNVQLVGFASLAADTYADGPASGNGISGNGRTGPFPGQPVQGFSAVQFANSGSFYFLSD
NGYGSKDNSADYLLRIYRLDPNFRGVENGDGSVKILDYIQLSDPNNKIPFQIVNEASADR
LLTGADLDIESFVIDKDGSIWVGDEFGPYLLHFDATGKLLDAPIATPDRFKTLDGTAPEV
IGHRGASGFRPEHTLESYKLAIEQGADFIEPDLAVTKDGVLIARHEPALAVLNADGSVNF
SNTTTNVYQIAKFSDRLKTVNLDGTEITGWFAEDFTLAEIKELRAIERLPFRDQSFNGQF
TIPTLAEIIDLVKQVEAETGKKIGIYPETKHPTYFAQEATYVGTTEKINRNISQILIDTL
KANNFTDPSRIFIQSFEVGNLKELHDTIMPNAGVDIPLVQLFDAIDVDINGRLIETRPYD
FIVSGDTRTYGDLRTPAGLAEIAEYADGIGPWKRMIVSVRGTDANNDGQADDVNGDGAVN
DADKTLLPPTTLVQDAHNVGLQVHPYTFRDEERYLAANYQGNPELEYQQLFQLGVDALFT
DFPITADRVRDRLSLPGNNIVRSPQNPDVLSGDAFANLGGSRGFEGGAINASKTKLYMLL
EGTVQGDPVGALRLNEFDLATRSYTNNLRYYRLENPAHAIGEITVINDNEYLVIERDGGQ
GASARFKKIYKINLSQTDANGFVAKQEIADLLNIQDPNDLNRDGKTTFDFPFVTIESVVV
VDSNTILVANDNNYPFSVGRPPAIDNNEIILLRLEQPLNLAPGVGQPQATEIKFGSPSSD
EITAEPGQILFTGDGADTVDSPGNNTISTGNGDDTVFVGSNASVSTGNGNDQVFIGVDSP
ASNTTANGGHGDDEITVIEAGGSNNLFGAAGNDTLQVIEGSRQFAFGGSGNDTLTSNGSY
NRLNGGSGDDKLFSSVNDSLFGGDGDDVLFAGQAGSNRLTGGAGADQFWIANGSLPTSKN
TVTDFAVGVDKIGLGGVGVTQFSALSLVQQGADTLVKLGATDLVILQGITSTSLTVTDFV
FAVSVVG
Download sequence
Identical sequences A0A1Z4KQF1 Q8Z028
WP_010994452.1.33676 gi|17227771|ref|NP_484319.1| 103690.all0275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]