SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17227786|ref|NP_484334.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17227786|ref|NP_484334.1|
Domain Number 1 Region: 147-432
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.48e-47
Family beta-glycanases 0.00035
Further Details:      
 
Domain Number 2 Region: 402-436,473-575
Classification Level Classification E-value
Superfamily beta-Roll 1.7e-22
Family Serralysin-like metalloprotease, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17227786|ref|NP_484334.1|
Sequence length 656
Comment hypothetical protein alr0290 [Nostoc sp. PCC 7120]
Sequence
MVIHITFIKMQPTNPNFSNVQIIKNKIYDLNGQAFITEVIHPFAWDDIYDIYLNIWGLDH
IRYADFLLENNHQAYSGYDNHEIDKKTVDIYTIQDAVVMFEIHDGIGAYKNISNPRNQFY
THGINISFGDYGSEDIGLDVTSAASKFSNFKIIGDKIYDPNGQEFIAKGINTFTWDKDYN
IYLDNWGFNTIRVPNYLLGSYNQPHPAQDNYQTNKNIVNVYTSQNAVVIFDAHDRIGGYY
QGDQWEILKDYWREMAKQFKDNPYVWFNLHNEPGNSQAQPEKWVNYHRQLIDIIRAEGAN
NVIVVDGEAWGQDYLTQTIASHAHNIMAGNENILFSLHVYDQWLNKDIGAYFDRLQAQDI
PIIVGEYGSENIGLDVTQASVNMMLAAQPREIGRIAWVGKANDNNDLTYGKGGHAYYFDG
NNTEILTDLGRLTWQDLQRSENLGYADHNFWTRFTSPDKASEASEQGVYDIVIRDISGNK
NFPNKLQSSIFISGDNGNNKFDGGDQDDVLIGGDGSDKLSGQNGNDLLVGGKGNDELTGG
SGNDIFYIDGRDVGKDIITDFNPQNDALYINNIMEIAQAWTDTGLDKANRYGHLGALRVT
NLKELADLTGVLNNLGGSFGAYTIKNQNQLILDLGDTVIHLNGLSNYVQPIQAPLI
Download sequence
Identical sequences A0A1Z4KQR6 Q8Z013
gi|17227786|ref|NP_484334.1| 103690.alr0290 WP_010994467.1.33676 NYSGXRC-11096p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]