SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17227828|ref|NP_484376.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17227828|ref|NP_484376.1|
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000275
Family Serralysin-like metalloprotease, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17227828|ref|NP_484376.1|
Sequence length 122
Comment hypothetical protein all0332 [Nostoc sp. PCC 7120]
Sequence
MTGGTESDRFLYSSGRAFTSNDFGIDILTDFTSGIDKLVLSKNTFRALTSVVGDGLSQVS
DFTTVEDDDLAATSTAFLVYSIGSGSLYYNQNGSAAGFGTGAELANLINLPSLTAADLAI
VA
Download sequence
Identical sequences A0A1Z4KQP3 Q8YZX3
gi|17227828|ref|NP_484376.1| WP_010994508.1.33676 103690.all0332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]