SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17228125|ref|NP_484673.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17228125|ref|NP_484673.1|
Domain Number - Region: 9-63
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0182
Family Di-heme elbow motif 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17228125|ref|NP_484673.1|
Sequence length 81
Comment hypothetical protein asl0629 [Nostoc sp. PCC 7120]
Sequence
MSKTPRIRIPPEVRQYVFQRDKFQCQSCGKTGLETNLTIDHIIPLARGGQNDISNLHTLC
FDCNRCKTDKLDSRFRRHFEI
Download sequence
Identical sequences A0A1Z4KRN3 Q8YZ58
WP_010994805.1.33676 gi|17228125|ref|NP_484673.1| NsR228 103690.asl0629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]