SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17228239|ref|NP_484787.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17228239|ref|NP_484787.1|
Domain Number 1 Region: 238-389
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000019
Family Clostridium neurotoxins, the second last domain 0.061
Further Details:      
 
Weak hits

Sequence:  gi|17228239|ref|NP_484787.1|
Domain Number - Region: 179-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00498
Family Leech intramolecular trans-sialidase, N-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17228239|ref|NP_484787.1|
Sequence length 494
Comment hypothetical protein alr0744 [Nostoc sp. PCC 7120]
Sequence
MVRSQQNPQKHNWLFFFISVFIVLIATLYPFDFSKIVKFSITELIASFNNSSSFQDQVNN
ILLFLPVGWSFGNLCQKSIRKITLQILFVILVSFGLSLTVEFLQIFLPSRSPTPADLLNN
SLGGLFGFICFSIWNAKSFSSTVEKLDSSRVSKSSKLIICFFCGYLILTLLISLLWQGTT
NLSNWDRNYYLSVGNEITGNKAWAGYVSEISIVDRAISKNEASQTLADANYLHKLGNSLV
AHYKLNGECCYQDQTGNQPELLWQGRSASTPKSQGAFLDAHHWLKTSTPVSHLSQRMSQT
SEFTISTAIATTNVDQKGPARIISVSGSSQRRNWTLGQQGNSLDFRLRTPLTGENGTELK
LNIPNVFTDTYLHHLVITYSRGNIQVYIDKLENFHSFNLLDLIPKEQRIFYYALTFMPLG
IGLGIITFLARKKLIFYRILFYSGILIPSLMLEGILVSESGKDFSIKHLLLGISFTAVTM
IFLRIRAARLKMIS
Download sequence
Identical sequences A0A1Z4KRW7 Q8YYV2
NsR458 103690.alr0744 gi|17228239|ref|NP_484787.1| WP_010994918.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]