SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17228549|ref|NP_485097.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17228549|ref|NP_485097.1|
Domain Number - Region: 11-37
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.000706
Family Intein (protein splicing domain) 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17228549|ref|NP_485097.1|
Sequence length 450
Comment DNA polymerase III subunit alpha [Nostoc sp. PCC 7120]
Sequence
MIKIASRKFLGVENVYDIGVRRDHNFFIKNGLIASNCFNKSHSTAYGYVTYQTAYLKANY
PLEYMAALLTANSNDTDKVQKYISTCLSMNIQIEPPDINRSGVDFTPVAGKILFGFSAVR
NVGQNAIASVLEARDTTGEFKSLADFCDRIDLRAVNRRTLESLIYCGAFDKIEANRHQLI
QDLELVYDWAQSRARDRASGQGNLFDLLGGYSSTNTKTANNAFETAPKAKPVLDYPPQEK
LRLEKELLGFYVSDHPLKSLRSVAPLLTPINLSQLGEQREDTRLCVIVMLNGVKKVMTKK
GDAMAILQLEDLTSQSEAVVFPKTYERISFLLQVDARLIIWGKVDRRDEQTQLIVEDAEP
VETVQMVMVELQPQQAANIEELHRLKTILQEQCGDKEKAKMPVIGIVQSENSRRLVRLGW
QFCVQDARITVQALQNARFSAQLKPLIGGS
Download sequence
Identical sequences A0A1Z4KSP3 Q8YY01
WP_010995228.1.33676 gi|17228549|ref|NP_485097.1| 103690.alr1054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]