SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17228679|ref|NP_485227.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17228679|ref|NP_485227.1|
Domain Number 1 Region: 24-158,214-386
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.02e-41
Family Filamentous hemagglutinin FhaB, secretion domain 0.015
Further Details:      
 
Domain Number 2 Region: 386-584
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000377
Family Filamentous hemagglutinin FhaB, secretion domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17228679|ref|NP_485227.1|
Sequence length 850
Comment hypothetical protein alr1184 [Nostoc sp. PCC 7120]
Sequence
MVILQQTKILFFFTFCLFLETPLKALAQTQLNPDNTLPTNVNNIGGGVYDITGGARPNNG
ANLFHSFQDFAIRSGDTARFIYDTGINNIITRVTGGSPSQINGTIQTLLNGTNNIGNANL
FLINPYGIIFGANAKLDIGGSFIGTTADSIKFTDGTEFSATNPTVNPILTVSVPLGLQFG
SHPTSTIQVQGSGNNLRLNPDFSIDSRNRPPGLSYKTPNGQTLALIAGKVELDGGNITVP
QGRVELWSVNQGEVTITNPSGQLQLQPTPGISYGNVNLLNAASVDTSGNSGGIIQARGQN
VTLENGSVIVTDTIGNGSGGILNISASEALTIKGFVLNPNNQVSSSILADVGSGASGEGG
KISISTKTLQVSNGGQISSGTFGTGNAGELNVTAQDVQVSGISPFGPSGLFAPVAPGARG
NGGSLGVETKKLQVTDGGQIFTTTYGFGQAGDLKILAEDVEVIGGTQFGPSIIAATTIKL
SAIPEPIATFLGAGFGTGGNLMIETNNLRVADGGQIAVSTSGNGSAGNMTITANSVELTG
TNQLGRSGLFANAIVGTGQGGDVNVSANRLVVRDGATINVSNLLSRDPQNLLGLAGQGAA
GDITLDSADILLANQGIITADTNAGDKGNITIQSDTLQMLRGSQISTNARNSAVGGNINI
TTNTLVAYENSDITANAQQGFGGRVVVNAKGIFGIQFRPQPTPYSDLTASSDLGAEFHGT
VESNTLDVDPTSGLVKLPTNFSDRSQQIASGCSTTQQNRFVVSNRGGLPANPTDTVRGEI
VWYDVRDLSNEVANSTASSNYQTASNQQPIVEAQGLIVSADGTIRLLASIPTVTPLTPWQ
VSPSCNVKPS
Download sequence
Identical sequences A0A1Z4KT75 Q8YXM8
gi|17228679|ref|NP_485227.1| 103690.alr1184 WP_010995357.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]