SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17228837|ref|NP_485385.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17228837|ref|NP_485385.1|
Domain Number 1 Region: 70-339
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.8e-38
Family Pectate transeliminase 0.033
Further Details:      
 
Weak hits

Sequence:  gi|17228837|ref|NP_485385.1|
Domain Number - Region: 586-618
Classification Level Classification E-value
Superfamily Sporulation related repeat 0.00183
Family Sporulation related repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17228837|ref|NP_485385.1|
Sequence length 621
Comment hypothetical protein all1342 [Nostoc sp. PCC 7120]
Sequence
MFRYHRLDTLQLKQTSLELARCAVSSLSILSTLAVCSITVLGTTPGSVIAQMPPVAEQMP
LSERTMSQVNVLLVNPSAGDDTAGNGNESTPLRTITQALKLARPGTVIQLTPGNYSVETG
ETFPLMLKPGVSIQGNTSNKGQEVKIQGGGLFLSRSFGGQNVAIVGANQAGLTGVTITNP
NPRGYGLWIESSNPVISENTFTGNTQDGISVTGNSATTITKNYFYRNGANGITIGGNSPA
QVRENLFEETGFGINVAQNAVPMLVSNQIQNNRSGIIVQANARPILRNNLIQGSKEDGVV
AIAQAMPDLGNATEAGGNEFRNNARHDINASAAKQAIAAVGNILDTKRITGKVALNAQDA
PVANNAPPTPISSRTLPSIPNEREVIFTAPNVSNATNKPNKSVVRGQGNSQLPALVSADA
PLTVPRYNQQPPAPIPEQVTNQNIPGNISVTSTTNLTPVATKRTQTAQLNYVQIDPNTIE
FVAPQPEQPEPIVNTQAPPLNVSPQSRVSNTSILPVPAGDIPLGNTRNLPKISAPQINTT
GISGNYLSATSGNSVRYRVVVEATNDREQELVKFLAPGAFSTFWQGRRVIQVGVFSDRSN
ADEMLRVLNSSGLRTIVEPLN
Download sequence
Identical sequences Q8YX73
gi|17228837|ref|NP_485385.1| WP_010995514.1.33676 103690.all1342 NsR102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]