SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17228892|ref|NP_485440.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17228892|ref|NP_485440.1|
Domain Number 1 Region: 64-341
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.32e-28
Family Filamentous hemagglutinin FhaB, secretion domain 0.0078
Further Details:      
 
Domain Number 2 Region: 756-944
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000581
Family Filamentous hemagglutinin FhaB, secretion domain 0.029
Further Details:      
 
Domain Number 3 Region: 522-688
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000151
Family iota-carrageenase 0.035
Further Details:      
 
Weak hits

Sequence:  gi|17228892|ref|NP_485440.1|
Domain Number - Region: 939-1005
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00847
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17228892|ref|NP_485440.1|
Sequence length 1280
Comment hypothetical protein alr1397 [Nostoc sp. PCC 7120]
Sequence
MYPTNTRNTIGLALLVIGSVIFAGNHVLAEIKTDTTLGSEASILNQGVSVKGAIGDIIDG
GAVRGTKLFHSFQEFSIGEGQRVYFSNPAGIKNILTRVTGNNRSDILGTLGVLGNANLFL
INPNGIVFGQNARLDIAGSFVASTVDSLTLGNGFVYSATKPEIPPLLNINLQPGLQLGTE
IGTITNRGNLAVGQNLILSANNLDLQGSLQAGQDLTLNARNQIQMRDTIASPLIAAAKEK
LLIQGNQSVNIFALNHPDSGLFSGGDMILRSLSDIDGDAHYWSRGNFRIEKLDGNLGGLF
SPDDPIIRSNGDVSLASFTGASLHILAGGKVEIPGNVIIFRPDNLSSAIAETVTLSDGNT
VNISGSTDSTLDIRAGINWQNLPGNSSLGQLSSLPSFNNATSADINLGNIRVFDFVGGQG
GKIFLTNQYQANPTLSGNIRVNIIDARDSFQGTSLFMNSRGNIAVNIADTSSFRQGNGGD
ITMIAQGNISPQLLLSRGWLGGNITLKSNANISVATGFISSQSRANTETGSPLTGGDIEI
TADSLFLTNGANITVINENISNGGNLKITANNIFLEGVPSNGSAGGITSQVWPGSIGKGG
DIQITTGKLSAEKGSQVIAITFGAGKAGNVTIHASDRIFLSGISNTGIPGGVASRSQDSG
AGGNVNITTRSLTIENSARVSTATTGRGTSGNVMINASDAIVLDGYDTAIISQAFPDTTA
GGNINVTTGKLSLFNGAAISSGTRGIGNAGNIQIIADMFIADGVSPITGFASGITAATDD
NAQGNGGNIDIISRIIALTNGGQITTSTDARGNAGNIKITTNAINIDGSSPLRENFPSGI
LSLVRANAQGTGGNIDINTGQMTLTNGGFLDASTFGQGNAGDIKIIANDAMILNSGNNSN
VSGDISSQVLSGAVGDGGDIEIFAHKLLLSNGFQIKAQTFGQGNAGNIKINTIDSVVLNG
SSPRTNSTGIFTSVGNGGFGTGGNIDIQTGKLTLDNRSIISAETVSNTGGDIRLQLNDRL
LLRRNSRISTTAGTAQAGGDGGNIIINTPFLLTAPLENNDITANAFSGSGGKIDITTQGI
LGFTPRTRADLEASLGTKDPSQLNPRSLPTSDITAISQANASLDGQVTIDTPDVDPGSGL
VALPTNVVDASRLIAQTCRSGGETTASQQSEFVITGRGGLPPKPSDPLSSDAIWQDLQPY
ALPDEKAGEQEEKSQGGFPSGRTSLRDATRMGAREQGEKSPTPIVEAQGWVTSTDGKITL
VAQAPTTTPHNSSFTPVSCS
Download sequence
Identical sequences Q8YX21
WP_010995569.1.33676 103690.alr1397 gi|17228892|ref|NP_485440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]