SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17228898|ref|NP_485446.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17228898|ref|NP_485446.1|
Domain Number 1 Region: 404-538
Classification Level Classification E-value
Superfamily beta-Roll 7.46e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.00077
Further Details:      
 
Domain Number 2 Region: 288-394
Classification Level Classification E-value
Superfamily beta-Roll 4.32e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.00056
Further Details:      
 
Domain Number 3 Region: 95-198
Classification Level Classification E-value
Superfamily beta-Roll 2.35e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.0011
Further Details:      
 
Domain Number 4 Region: 3-86
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000222
Family Serralysin-like metalloprotease, C-terminal domain 0.0016
Further Details:      
 
Domain Number 5 Region: 162-269
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000929
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17228898|ref|NP_485446.1|
Sequence length 556
Comment hypothetical protein alr1403 [Nostoc sp. PCC 7120]
Sequence
MGGDDILTGGSQNDTIEGGEGKDTINGGAGFDILKGGDGDDTLIDTEGNIDGGAGTDTLR
ADYSKYDNGAGVHVGYLGQAQIFSRQTGTGILGYSNIEKFEITGTKYADILQGGVGNDVL
KGGAGNDELSGGAGNDTLDGGTGFDILKGGDGDDTLIDTEGNIDGGAGTDTLRADYSRYD
NGAGVHVGYLGQAQIFSRLTGTGILGYSNIEKFEITGTNYADILQGGSGNDILKGGAGND
ELSGKGGNDTLDGGFGYDTVVYDGNYADYGISFLSNGDLQVIDKNLTNGNDGTDTIRGVE
VINFRQGGSYGVVTGTTGNDVLTASNMWSFVFGGGGNDIITGGTGNDTLDGSTGNDTLIG
GAGNDTLIGGAGVDTAVYAGNYADYGISFLSNGDLQVIDKNLTNGNDGTDILKGVEVINF
TQGGSYGVVTGTTGNNVLTASNMWSFVFGGNGNDTITGGTGNDTLVGGLGADTLTGGLGA
DKFVFNSLSEGIDVIKDFSWQQGDKIQILGSSFGATSTSQFSFDQNTGGLFFNAQQFATL
ENKPAGFLTNADIQIV
Download sequence
Identical sequences Q8YX15
103690.alr1403 gi|17228898|ref|NP_485446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]