SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17229188|ref|NP_485736.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17229188|ref|NP_485736.1|
Domain Number 1 Region: 640-753
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 4.71e-28
Family Hypothetical protein PA1324 0.011
Further Details:      
 
Domain Number 2 Region: 871-982
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 7.72e-28
Family Hypothetical protein PA1324 0.011
Further Details:      
 
Domain Number 3 Region: 412-526
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 2.22e-27
Family Hypothetical protein PA1324 0.0096
Further Details:      
 
Domain Number 4 Region: 300-411
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 2.09e-26
Family Hypothetical protein PA1324 0.015
Further Details:      
 
Domain Number 5 Region: 756-878
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 2.88e-26
Family Hypothetical protein PA1324 0.011
Further Details:      
 
Domain Number 6 Region: 530-639
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 5.36e-26
Family Hypothetical protein PA1324 0.015
Further Details:      
 
Domain Number 7 Region: 984-1104
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 6.02e-22
Family Hypothetical protein PA1324 0.017
Further Details:      
 
Domain Number 8 Region: 194-290
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 1.57e-20
Family Hypothetical protein PA1324 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17229188|ref|NP_485736.1|
Sequence length 1999
Comment hypothetical protein all1696 [Nostoc sp. PCC 7120]
Sequence
MSLTDDLLQALKLTLPDNNVNIVVAYPGSGGDGPSYVDLTISNGNFLNGLYDTYCIDANQ
TIVPGQSYQAQVYSSYNDPLPTGIIDKPENLDEINWLINQKFVGKQSSGGLGAYTSGDIQ
VAIWTLLENTVPSNILGTVGAYNQNRANQIVEAAFQNGGGFVPGISQDGIPQDIGIIVVP
VNQTGTNIAQSTINILKTAALGDFVWEDLNANGVQDANEAGVEGVTVTLTGGGKDGVIGT
ADDTNVTTTTDANGSYLFPLLLPGVEYKVTFSNLPTGFVFTQSNQGNDTTDSDADPLTGQ
AQIIELNPNEFNRTIDAGIYRKASLGDFVFKDANNNGIQDAGEVGVGQVTVELINPTNGD
VIATTTTNSSGGYQFSGLTPGNYQVRFTAPTGYIFSTANQGSNDELDSDANPSTGLTQTL
TLTSGEFNGTLDAGLVPLASLGNFVFEDKNANGIQDAGETGIGNATVNLLDAAENIIATA
TTDDNGLYSFTNLRPGDYKVQFVQPNGFNGVSPQNVGGNDAIDSDGLVSDIVNLSPGEND
TTVDAGFYKTASLGDFVFKDANNNGIQDAGEVGVGQVTVELINPTNGDVIATTTTNSSGG
YQFSGLTPGNYQVRFTAPTGYIFSTANQGSNDELDSDANPSTGLTQTLTLASGEFNGTLD
AGLVPLASLGNFVFEDKNANGIQDAGETGIGDATVKLLDTSGNVIATTTTDGNGLYSFTN
LQPGDYKVQFIQPSGFDGISPKNVGGNDAIDSDGLISDVVNLSPGENDTTVDAGFYQTAS
LGDFVFNDVNNNGIQDAGEIGVGGVTVELINPANGDVIATTTTDANGGYGFSGLTPGEYQ
VKFTAPAGYNFSLANQGNNDALDSDANVSTGITQTLTLASGEFNGTLDAGLVPLASLGNF
VFEDKNANGIQDAGETGIGDATVKLLDTSGNVIATTTTDGNGLYSFTNLRPGDYKVQFVQ
PNGFNGVSPQNVGGNDAIDSDGLISDVVNLSPGENDTTVDAGFYKTASLGDFVFNDVNNN
GIQDAGEVGVAGVSVTLTGGGADGIINGIGDTTVTTTTNAGGNYNFAELTPGQQYQVGFS
GLPAGFQFTQANVGANDVVDSDANPSTGKTQVVTLVSGENNLTLDAGIYQNAGDLSITKT
DGLTNVTPGQQITYTIVARNNGLITATNALVSDIIPSNLTNVTWTSVASGGATDNQASGT
GNINDHVTLTGGSSITYTVTGTVVSNAASTGSSTRFDFDGNSPLDGTDGNTRTFTQNGIT
VTARAFSRVDGTNGAWSAAYLGSYTGGLGVTDSSEGNGGNNTHVVDNVGGRDNYVLFQFS
EAVVLDKAYLQYVLKDSDISVWIGNFNNPLTNLSDSTLNSFGFYEANVTTSSSDRWADVN
AGNYVGNTIVIAALDTDTSPEDNFKLRYLDVLKAIPASLVNTATITAPNGFTDTNPNNNS
ATDTNTIVAPSGDLSITKTDGLTNVTPGQQITYTIVARNNGLITATNALVSDIIPSNLTN
VTWTSVASGGATDNQASGTGNINDHVTLTGGSSITYTVTGTVVSNAASTGSSTRFDFDGN
SPLDGTDGNTRTFTQNGITVTARAFSRVDGTNGAWSAAYLGSYTGGLGVTDSSEGNGGNN
THVVDNVGGRDNYVLFQFSEAVVLDKAYLQYVLKDSDISVWIGNFNNPLTNLSDSTLNSF
GFYEANVTNSSSDRWADVNAGNYVGNTIVIAALDTDTSPEDNFKIRYLDVLKATPVSLVN
TATITAPNGFTDTNPSNNSATDTNTVIAAPGVRTPDFWANTEWQKFWDGNQGNEPTQKTL
TSDLLFAPYTNSAQSGKVLDPVTGQYHVGLLIGDFNRNGITDAGEDTLFYTLNQARQIVN
SSAHPNADKRYDLGRSLVASWLNYVAGNPIDTANATDKDARYYIKEGINWLQALTPDENG
DKKGDGAIHQMTGSSVTSPGFNDTWWSYGISSASSLPNAYKSNTNVSYGIDAGTTINSNL
EHYNNGLGLADHVFSGGNA
Download sequence
Identical sequences Q8YWB9
gi|17229188|ref|NP_485736.1| 103690.all1696 WP_010995865.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]